BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0317.0002.p (87 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P54522|EX7S_BACSU Probable exodeoxyribonuclease VII small sub... 72 3e-12 ref|NP_243648.1| exodeoxyribonuclease VII (small subunit) [Bacil... 71 7e-12 ref|ZP_00183144.1| hypothetical protein Exigu150401 [Exiguobacte... 71 8e-12 ref|NP_692799.1| exodeoxyribonuclease VII small subunit [Oceanob... 71 1e-11 ref|ZP_00097860.1| COG1722: Exonuclease VII small subunit [Desul... 66 2e-10 >sp|P54522|EX7S_BACSU Probable exodeoxyribonuclease VII small subunit (Exonuclease VII small subunit) Length = 75 Score = 72.4 bits (176), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 38/76 (50%), Positives = 55/76 (72%), Gaps = 2/76 (2%) Query: 9 LDFEGAMERLEEIVRELEHGDVPLEKAIDLFQQGMKLSQLCGNKLEQVERKIEMITEMDG 68 + FE AM+ LE IV +LE GDVPLE+AI+ FQ+GM LS++C KL++VE++++ I + DG Sbjct: 1 MTFEEAMKGLESIVSKLEEGDVPLEQAINYFQEGMALSKMCHEKLQKVEKQMDFILKEDG 60 Query: 69 ELRKKPFGARLEGDSD 84 EL PF + E + D Sbjct: 61 ELA--PFSVQEEDEGD 74 >ref|NP_243648.1| exodeoxyribonuclease VII (small subunit) [Bacillus halodurans] sp|Q9K968|EX7S_BACHD Probable exodeoxyribonuclease VII small subunit (Exonuclease VII small subunit) pir||F83997 exodeoxyribonuclease VII (small subunit) BH2782 [imported] - Bacillus halodurans (strain C-125) dbj|BAB06501.1| exodeoxyribonuclease VII (small subunit) [Bacillus halodurans] Length = 80 Score = 71.2 bits (173), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 36/68 (52%), Positives = 50/68 (73%) Query: 1 MAKEAELELDFEGAMERLEEIVRELEHGDVPLEKAIDLFQQGMKLSQLCGNKLEQVERKI 60 M K + L FE AME+LEE+V +LE GDVPLE+AI +FQ+GM LS++C KL VE+++ Sbjct: 1 MIKNEQPPLSFEEAMEQLEEVVEQLEQGDVPLEEAISMFQKGMNLSKVCHEKLATVEKQM 60 Query: 61 EMITEMDG 68 + I + DG Sbjct: 61 DQILKEDG 68 >ref|ZP_00183144.1| hypothetical protein Exigu150401 [Exiguobacterium sp. 255-15] Length = 73 Score = 70.9 bits (172), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 35/68 (51%), Positives = 50/68 (73%) Query: 6 ELELDFEGAMERLEEIVRELEHGDVPLEKAIDLFQQGMKLSQLCGNKLEQVERKIEMITE 65 E E FE A+ERLEEIV LE G+ PLE+A++L+++G+KL+ LC KL E++++ I E Sbjct: 2 ETEQSFEAALERLEEIVELLEAGEAPLEQAMNLYEEGVKLTALCQGKLSTAEKRLDQILE 61 Query: 66 MDGELRKK 73 DG LR+K Sbjct: 62 QDGTLREK 69 >ref|NP_692799.1| exodeoxyribonuclease VII small subunit [Oceanobacillus iheyensis HTE831] sp|Q8EQ45|EX7S_OCEIH Probable exodeoxyribonuclease VII small subunit (Exonuclease VII small subunit) dbj|BAC13834.1| exodeoxyribonuclease VII small subunit [Oceanobacillus iheyensis HTE831] Length = 78 Score = 70.9 bits (172), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 40/79 (50%), Positives = 52/79 (65%), Gaps = 2/79 (2%) Query: 5 AELELDFEGAMERLEEIVRELEHGDVPLEKAIDLFQQGMKLSQLCGNKLEQVERKIEMIT 64 A +L FE AME+LE IV +LE GDVPLEKAI+ +Q+GM LS+LC KL V+ K+ I Sbjct: 2 ATKDLTFEQAMEKLEGIVSKLEEGDVPLEKAIEYYQEGMNLSKLCSEKLNHVQDKMVQIM 61 Query: 65 EMDGELRKKPFGARLEGDS 83 GEL +PF + + S Sbjct: 62 NEQGEL--EPFDIQEDSSS 78 >ref|ZP_00097860.1| COG1722: Exonuclease VII small subunit [Desulfitobacterium hafniense] Length = 82 Score = 66.2 bits (160), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 35/75 (46%), Positives = 54/75 (72%), Gaps = 1/75 (1%) Query: 8 ELDFEGAMERLEEIVRELEHGDVPLEKAIDLFQQGMKLSQLCGNKLEQVERKIEMITEM- 66 EL FE +E LE IVRELE +VPLE+A++LF+QG++L Q C N+L+ E++++++ E Sbjct: 8 ELSFEEGIEHLERIVRELEQKEVPLEQALNLFRQGIELVQKCNNQLDYAEKQMQILLENP 67 Query: 67 DGELRKKPFGARLEG 81 +GEL +P +EG Sbjct: 68 NGELEVRPADFPVEG 82 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.313 0.136 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 121,920,231 Number of extensions: 4163180 Number of successful extensions: 13953 Number of sequences better than 1.0e-05: 115 Number of HSP's gapped: 13953 Number of HSP's successfully gapped: 115 Length of query: 87 Length of database: 757,237,578 Length adjustment: 56 Effective length of query: 31 Effective length of database: 605,192,034 Effective search space: 18760953054 Effective search space used: 18760953054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)