BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0317.0001.p (83 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_833893.1| Exodeoxyribonuclease VII large subunit [Bacillu... 81 6e-15 ref|NP_980546.1| exodeoxyribonuclease VII, large subunit [Bacill... 81 6e-15 ref|NP_658216.1| Exonuc_VII_L, Exonuclease VII, large subunit [B... 81 6e-15 ref|NP_390310.1| similar to exodeoxyribonuclease VII (large subu... 65 6e-10 ref|NP_243649.1| exodeoxyribonuclease VII (large subunit) [Bacil... 64 1e-09 >ref|NP_833893.1| Exodeoxyribonuclease VII large subunit [Bacillus cereus ATCC 14579] gb|AAP11094.1| Exodeoxyribonuclease VII large subunit [Bacillus cereus ATCC 14579] Length = 452 Score = 81.3 bits (199), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 42/81 (51%), Positives = 55/81 (67%), Gaps = 1/81 (1%) Query: 1 MQVRLQEKRSRFAAELRHLDALSPLKVMSRGYSLVYDEKEEHLIKSLKEVELGDVVNIKL 60 MQ LQ K F + L+ALSPLKVM RGY LVYDE E+ ++KS+K+V LGD V+++L Sbjct: 373 MQTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDE-EKQVLKSVKDVSLGDAVSVQL 431 Query: 61 NDGQLSCQVWGMREDGITNGE 81 DG L C V G+ E + NG+ Sbjct: 432 QDGILDCSVSGIEERELNNGK 452 >ref|NP_980546.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus ATCC 10987] gb|AAS43154.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus ATCC 10987] Length = 452 Score = 81.3 bits (199), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 42/81 (51%), Positives = 55/81 (67%), Gaps = 1/81 (1%) Query: 1 MQVRLQEKRSRFAAELRHLDALSPLKVMSRGYSLVYDEKEEHLIKSLKEVELGDVVNIKL 60 MQ LQ K F + L+ALSPLKVM RGY LVYDE E+ ++KS+K+V LGD V+++L Sbjct: 373 MQTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDE-EKQVLKSVKDVSLGDAVSVQL 431 Query: 61 NDGQLSCQVWGMREDGITNGE 81 DG L C V G+ E + NG+ Sbjct: 432 QDGILDCSVSGIEERELNNGK 452 >ref|NP_658216.1| Exonuc_VII_L, Exonuclease VII, large subunit [Bacillus anthracis A2012] ref|NP_846632.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str. Ames] gb|AAP28118.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str. Ames] Length = 452 Score = 81.3 bits (199), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 42/81 (51%), Positives = 55/81 (67%), Gaps = 1/81 (1%) Query: 1 MQVRLQEKRSRFAAELRHLDALSPLKVMSRGYSLVYDEKEEHLIKSLKEVELGDVVNIKL 60 MQ LQ K F + L+ALSPLKVM RGY LVYDE E+ ++KS+K+V LGD V+++L Sbjct: 373 MQTLLQAKEFAFVRAAQKLEALSPLKVMMRGYGLVYDE-EKQVLKSVKDVSLGDAVSVQL 431 Query: 61 NDGQLSCQVWGMREDGITNGE 81 DG L C V G+ E + NG+ Sbjct: 432 QDGILDCSVSGIEERELNNGK 452 >ref|NP_390310.1| similar to exodeoxyribonuclease VII (large subunit) [Bacillus subtilis] sp|P54521|EX7L_BACSU Probable exodeoxyribonuclease VII large subunit (Exonuclease VII large subunit) pir||G69960 exodeoxyribonuclease VII (large subunit) homolog yqiB - Bacillus subtilis dbj|BAA12573.1| YqiB [Bacillus subtilis] emb|CAB14361.1| yqiB [Bacillus subtilis subsp. subtilis str. 168] Length = 448 Score = 64.7 bits (156), Expect = 6e-10, Method: Composition-based stats. Identities = 35/73 (47%), Positives = 50/73 (68%), Gaps = 2/73 (2%) Query: 1 MQVRLQEKRSRFAAELRHLDALSPLKVMSRGYSLVYDEKEEHLIKSLKEVELGDVVNIKL 60 M +++++ S+F L L+ALSPL+VM RGYSL Y KE+ LIKS+ ++E D + IKL Sbjct: 374 MNIQMKQLHSQFQTVLGKLNALSPLQVMERGYSLAY--KEDKLIKSVSQIEEQDRLEIKL 431 Query: 61 NDGQLSCQVWGMR 73 DG L+C+V R Sbjct: 432 KDGVLTCEVLEKR 444 >ref|NP_243649.1| exodeoxyribonuclease VII (large subunit) [Bacillus halodurans] sp|Q9K967|EX7L_BACHD Probable exodeoxyribonuclease VII large subunit (Exonuclease VII large subunit) pir||G83997 exodeoxyribonuclease VII (large subunit) BH2783 [imported] - Bacillus halodurans (strain C-125) dbj|BAB06502.1| exodeoxyribonuclease VII (large subunit) [Bacillus halodurans] Length = 458 Score = 63.5 bits (153), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 2/82 (2%) Query: 1 MQVRLQEKRSRFAAELRHLDALSPLKVMSRGYSLVYDEKEEHLIKSLKEVELGDVVNIKL 60 Q ++ K +F + L+ LSPL+VM RGY+L Y K + LIKS+K+V + D +++++ Sbjct: 375 FQQMMERKEQQFQQAISSLNLLSPLRVMERGYALPYKAKTQELIKSVKQVRMNDRLHLRV 434 Query: 61 NDGQLSCQVWGMREDGITNGEG 82 DGQL C V + + + GEG Sbjct: 435 TDGQLICDVKEIESE--SGGEG 454 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 117,984,287 Number of extensions: 3931017 Number of successful extensions: 9632 Number of sequences better than 1.0e-05: 18 Number of HSP's gapped: 9708 Number of HSP's successfully gapped: 18 Length of query: 83 Length of database: 757,237,578 Length adjustment: 52 Effective length of query: 31 Effective length of database: 616,052,430 Effective search space: 19097625330 Effective search space used: 19097625330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 120 (50.8 bits)