BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0307.0090.p
         (49 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_863853.1| probable xanthan lyase [Pirellula sp. 1] >gi|32...    57   2e-07

>ref|NP_863853.1| probable xanthan lyase [Pirellula sp. 1]
 emb|CAD71526.1| probable xanthan lyase [Pirellula sp.]
          Length = 700

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/45 (57%), Positives = 34/45 (75%)

Query: 1   MESVFMVLGQSAAVAASISMSDQVTVQEVEYKKLKERLLQVNQIL 45
           ME VFMVLGQ+ A AA I++ DQV VQ V+Y++L  RLL+  Q+L
Sbjct: 503 MEPVFMVLGQTTATAAVIAIDDQVAVQNVDYERLASRLLEDKQVL 547


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.318    0.127    0.319 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 49,480,913
Number of extensions: 967281
Number of successful extensions: 3745
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 3745
Number of HSP's successfully gapped: 1
Length of query: 49
Length of database: 757,237,578
Length adjustment: 22
Effective length of query: 27
Effective length of database: 697,505,400
Effective search space: 18832645800
Effective search space used: 18832645800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 120 (50.8 bits)