BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0305.0004.p (91 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q7WY61|YRZL_BACSU Hypothetical UPF0297 protein yrzL >gi|32468... 119 2e-26 ref|NP_980763.1| conserved hypothetical protein [Bacillus cereus... 118 5e-26 ref|NP_658416.1| hypothetical protein predicted by GeneMark [Bac... 118 5e-26 ref|NP_242134.1| BH1268~unknown [Bacillus halodurans] >gi|425600... 117 7e-26 ref|ZP_00182270.1| hypothetical protein Exigu243601 [Exiguobacte... 117 8e-26 >sp|Q7WY61|YRZL_BACSU Hypothetical UPF0297 protein yrzL emb|CAE01464.1| yrzL [Bacillus subtilis subsp. subtilis str. 168] Length = 88 Score = 119 bits (298), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 56/86 (65%), Positives = 68/86 (79%) Query: 1 MDSMDKTVKFNVKGDEKEASSEEILLAVYDALVEKEYHPINQIVGYLISGDPAYIPRHNN 60 M S DKT+KFN D E + E+L+ VYDAL EK Y+PINQIVGYL+SGDPAYIPRH + Sbjct: 1 MSSFDKTMKFNFSDDSAETNVNEVLITVYDALQEKGYNPINQIVGYLLSGDPAYIPRHRD 60 Query: 61 ARSLVRRKERDELIEELVRFYLVNHR 86 AR+L+R+ ERDELIEELV+ YL H+ Sbjct: 61 ARNLIRKLERDELIEELVKSYLEQHK 86 >ref|NP_980763.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS43371.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 125 Score = 118 bits (295), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 54/86 (62%), Positives = 71/86 (82%) Query: 1 MDSMDKTVKFNVKGDEKEASSEEILLAVYDALVEKEYHPINQIVGYLISGDPAYIPRHNN 60 MD DKT+KF+++ +++ ++LL VYDAL EK Y+PINQIVGYL+SGDPAYIPRH + Sbjct: 38 MDGFDKTMKFSIQDEKQSVHVNDVLLTVYDALQEKGYNPINQIVGYLLSGDPAYIPRHKD 97 Query: 61 ARSLVRRKERDELIEELVRFYLVNHR 86 ARS++R+ ERDELIEELV+ YL +HR Sbjct: 98 ARSIIRKLERDELIEELVKSYLKHHR 123 >ref|NP_658416.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_834094.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] ref|NP_846834.1| conserved hypothetical protein [Bacillus anthracis str. Ames] sp|Q812R8|Y7I2_BACCR Hypothetical UPF0297 protein BC4382 sp|Q81LK1|YAB5_BACAA Hypothetical UPF0297 protein BA4615 gb|AAP11295.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] gb|AAP28320.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 88 Score = 118 bits (295), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 54/86 (62%), Positives = 71/86 (82%) Query: 1 MDSMDKTVKFNVKGDEKEASSEEILLAVYDALVEKEYHPINQIVGYLISGDPAYIPRHNN 60 MD DKT+KF+++ +++ ++LL VYDAL EK Y+PINQIVGYL+SGDPAYIPRH + Sbjct: 1 MDGFDKTMKFSIQDEKQSVHVNDVLLTVYDALQEKGYNPINQIVGYLLSGDPAYIPRHKD 60 Query: 61 ARSLVRRKERDELIEELVRFYLVNHR 86 ARS++R+ ERDELIEELV+ YL +HR Sbjct: 61 ARSIIRKLERDELIEELVKSYLKHHR 86 >ref|NP_242134.1| BH1268~unknown [Bacillus halodurans] sp|Q9KDE5|YC68_BACHD Hypothetical UPF0297 protein BH1268 pir||D83808 hypothetical protein BH1268 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04987.1| BH1268~unknown [Bacillus halodurans] Length = 90 Score = 117 bits (294), Expect = 7e-26, Method: Compositional matrix adjust. Identities = 55/86 (63%), Positives = 69/86 (80%) Query: 1 MDSMDKTVKFNVKGDEKEASSEEILLAVYDALVEKEYHPINQIVGYLISGDPAYIPRHNN 60 M SMD T+KFNV + +E+L++VY+AL EK Y+PINQIVGYL+SGDPAYIPRH + Sbjct: 1 MSSMDNTMKFNVNEEPVSVDVQEVLMSVYEALEEKGYNPINQIVGYLLSGDPAYIPRHKD 60 Query: 61 ARSLVRRKERDELIEELVRFYLVNHR 86 AR+L+R+ ERDELIEELV+ YL HR Sbjct: 61 ARTLIRKLERDELIEELVKSYLSQHR 86 >ref|ZP_00182270.1| hypothetical protein Exigu243601 [Exiguobacterium sp. 255-15] Length = 86 Score = 117 bits (293), Expect = 8e-26, Method: Compositional matrix adjust. Identities = 53/79 (67%), Positives = 68/79 (86%) Query: 4 MDKTVKFNVKGDEKEASSEEILLAVYDALVEKEYHPINQIVGYLISGDPAYIPRHNNARS 63 MD+T+KFN D+ +A++ E+LL VY AL EK YHPINQIVGYL+SGDPAYIPRHN+AR+ Sbjct: 1 MDQTMKFNFPEDDSQAATREVLLTVYHALEEKGYHPINQIVGYLLSGDPAYIPRHNDARN 60 Query: 64 LVRRKERDELIEELVRFYL 82 ++R+ ERDEL+EELV+ YL Sbjct: 61 MIRKIERDELLEELVKSYL 79 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.316 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 132,213,333 Number of extensions: 4624733 Number of successful extensions: 12303 Number of sequences better than 1.0e-05: 27 Number of HSP's gapped: 12300 Number of HSP's successfully gapped: 27 Length of query: 91 Length of database: 757,237,578 Length adjustment: 59 Effective length of query: 32 Effective length of database: 597,046,737 Effective search space: 19105495584 Effective search space used: 19105495584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)