BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0303.0011.p (155 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_389217.1| similar to transcriptional regulator (MarR fami... 166 2e-40 ref|NP_389250.1| similar to transcriptional regulator (MarR fami... 138 4e-32 ref|NP_977771.1| transcriptional regulator, MarR family [Bacillu... 137 1e-31 ref|NP_655239.1| MarR, MarR family [Bacillus anthracis A2012] >g... 136 1e-31 ref|NP_831118.1| Transcriptional regulator, MarR family [Bacillu... 135 3e-31 >ref|NP_389217.1| similar to transcriptional regulator (MarR family) [Bacillus subtilis] pir||A69860 transcription regulator MarR family homolog ykoM - Bacillus subtilis emb|CAA05611.1| YkoM [Bacillus subtilis] emb|CAB13191.1| ykoM [Bacillus subtilis subsp. subtilis str. 168] Length = 154 Score = 166 bits (419), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 75/144 (52%), Positives = 111/144 (77%) Query: 6 ERDTQLTLHLYRVFAKSFKSINEHAVTGSKIEGFNPTAFAVMEVLYYKGPQPIQQIGAKL 65 E + + ++LYRVFA++FKS++EH++ SK GFNPT FAV+E+LY +GPQ +QQIG++L Sbjct: 8 EEEVERAMNLYRVFARAFKSVSEHSIRDSKEHGFNPTEFAVLELLYTRGPQKLQQIGSRL 67 Query: 66 LLQSGNVTYVIDKLEERGYLQRKPCPSDRRVIFAELTSEGERLMNEMYPKYSERLHLAFS 125 LL SGNVTYVIDKLE G+L R+ P D+R ++A LT +G ++++YP ++ R+ AFS Sbjct: 68 LLVSGNVTYVIDKLERNGFLVREQDPKDKRSVYAHLTDKGNEYLDKIYPIHALRIARAFS 127 Query: 126 GLSDEEKEQMITLLKKMGLQAEKL 149 GLS +E++Q+I LLKK G+ ++ L Sbjct: 128 GLSPDEQDQLIVLLKKAGIHSQHL 151 >ref|NP_389250.1| similar to transcriptional regulator (MarR family) [Bacillus subtilis] pir||G69867 transcription regulator MarR family homolog ykvE - Bacillus subtilis emb|CAB13240.1| ykvE [Bacillus subtilis subsp. subtilis str. 168] Length = 145 Score = 138 bits (347), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 64/141 (45%), Positives = 100/141 (70%) Query: 9 TQLTLHLYRVFAKSFKSINEHAVTGSKIEGFNPTAFAVMEVLYYKGPQPIQQIGAKLLLQ 68 T+ +L L+ V +++++SIN+H G NPT FAV+E+LY+KG QP+QQIG K+LL Sbjct: 2 TEKSLKLFIVLSRAYRSINDHMNKHIHKHGLNPTEFAVLELLYHKGDQPLQQIGDKILLA 61 Query: 69 SGNVTYVIDKLEERGYLQRKPCPSDRRVIFAELTSEGERLMNEMYPKYSERLHLAFSGLS 128 SG++TYV+DKLE++ L RK P+DRRV FA++T +G L+N+++P ++ + S LS Sbjct: 62 SGSITYVVDKLEQKELLIRKASPTDRRVTFAQITEKGIGLLNDIFPDHAAEIDEMISVLS 121 Query: 129 DEEKEQMITLLKKMGLQAEKL 149 +EE E +LK++GL A++ Sbjct: 122 EEEVEMCTEMLKRVGLNAKQF 142 >ref|NP_977771.1| transcriptional regulator, MarR family [Bacillus cereus ATCC 10987] gb|AAS40379.1| transcriptional regulator, MarR family [Bacillus cereus ATCC 10987] Length = 148 Score = 137 bits (344), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 61/144 (42%), Positives = 101/144 (70%), Gaps = 1/144 (0%) Query: 1 MIQSYER-DTQLTLHLYRVFAKSFKSINEHAVTGSKIEGFNPTAFAVMEVLYYKGPQPIQ 59 M + ER D +L ++ ++ +S+ + + G NPT FAV+E+LY+KG QP+Q Sbjct: 1 MTSNNEREDISQSLKVFIALSRVHRSVMDTTNKSIQSNGLNPTEFAVLELLYHKGGQPLQ 60 Query: 60 QIGAKLLLQSGNVTYVIDKLEERGYLQRKPCPSDRRVIFAELTSEGERLMNEMYPKYSER 119 QIG ++L+ SG++TYV+DKLE++G ++R PCP+DRRVI+A+LT GE + ++P + + Sbjct: 61 QIGERILIASGSITYVVDKLEKKGLVKRIPCPNDRRVIYAQLTESGENFIASIFPGHEQV 120 Query: 120 LHLAFSGLSDEEKEQMITLLKKMG 143 +H +F L+ EEK++++ LLKK+G Sbjct: 121 IHQSFEMLTKEEKDELLDLLKKIG 144 >ref|NP_655239.1| MarR, MarR family [Bacillus anthracis A2012] ref|NP_843812.1| transcriptional regulator, MarR family [Bacillus anthracis str. Ames] gb|AAP25298.1| transcriptional regulator, MarR family [Bacillus anthracis str. Ames] Length = 148 Score = 136 bits (343), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 61/144 (42%), Positives = 101/144 (70%), Gaps = 1/144 (0%) Query: 1 MIQSYER-DTQLTLHLYRVFAKSFKSINEHAVTGSKIEGFNPTAFAVMEVLYYKGPQPIQ 59 M + ER D +L ++ ++ +S+ + + G NPT FAV+E+LY+KG QP+Q Sbjct: 1 MTSNNEREDISQSLKVFIALSRVHRSVMDTTNKSIQSNGLNPTEFAVLELLYHKGGQPLQ 60 Query: 60 QIGAKLLLQSGNVTYVIDKLEERGYLQRKPCPSDRRVIFAELTSEGERLMNEMYPKYSER 119 QIG ++L+ SG++TYV+DKLE++G ++R PCP+DRRVI+A+LT GE + ++P + + Sbjct: 61 QIGERILIASGSITYVVDKLEKKGLVKRIPCPNDRRVIYAQLTESGETFIASIFPGHEQV 120 Query: 120 LHLAFSGLSDEEKEQMITLLKKMG 143 +H +F L+ EEK++++ LLKK+G Sbjct: 121 IHQSFEMLTKEEKDELLDLLKKIG 144 >ref|NP_831118.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] gb|AAP08319.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] Length = 148 Score = 135 bits (340), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 60/144 (41%), Positives = 101/144 (70%), Gaps = 1/144 (0%) Query: 1 MIQSYER-DTQLTLHLYRVFAKSFKSINEHAVTGSKIEGFNPTAFAVMEVLYYKGPQPIQ 59 M + ER D +L ++ ++ +S+ + + G NPT FAV+E+LY+KG QP+Q Sbjct: 1 MTSNNEREDISQSLKVFIALSRVHRSVMDTTNKSIQSNGLNPTEFAVLELLYHKGGQPLQ 60 Query: 60 QIGAKLLLQSGNVTYVIDKLEERGYLQRKPCPSDRRVIFAELTSEGERLMNEMYPKYSER 119 QIG ++L+ SG++TYV+DKLE++G ++R PCP+DRRVI+A+LT GE + ++P + + Sbjct: 61 QIGERILIASGSITYVVDKLEKKGLVKRIPCPNDRRVIYAQLTESGENFIASIFPGHEKV 120 Query: 120 LHLAFSGLSDEEKEQMITLLKKMG 143 +H +F L+ +EK++++ LLKK+G Sbjct: 121 IHQSFEMLTKDEKDELLDLLKKIG 144 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 216,972,112 Number of extensions: 8368655 Number of successful extensions: 24201 Number of sequences better than 1.0e-05: 129 Number of HSP's gapped: 24249 Number of HSP's successfully gapped: 129 Length of query: 155 Length of database: 757,237,578 Length adjustment: 113 Effective length of query: 42 Effective length of database: 450,431,391 Effective search space: 18918118422 Effective search space used: 18918118422 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)