BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0301.0034.p (82 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_653441.1| hypothetical protein predicted by GeneMark [Bac... 119 2e-26 ref|NP_244319.1| BH3452~unknown conserved protein [Bacillus halo... 113 2e-24 ref|NP_834647.1| hypothetical protein [Bacillus cereus ATCC 1457... 113 2e-24 ref|NP_391116.1| yunC [Bacillus subtilis] >gi|7475446|pir||F7001... 110 9e-24 ref|NP_693293.1| hypothetical protein OB2372 [Oceanobacillus ihe... 91 7e-18 >ref|NP_653441.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_847391.1| conserved hypothetical protein [Bacillus anthracis str. Ames] ref|NP_981405.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAP28877.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAS44013.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 100 Score = 119 bits (299), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 61/81 (75%), Positives = 66/81 (81%) Query: 1 VKLPKTTLLSISTGKGYIMCGALDVGLLNETLSDRGIIAARAVGVRTLPQLLAAPLESVT 60 VKLPKT LL++ + KGYIMCGALDVGLLNE L DRGIIA RAVGVRT+ QLL APLESVT Sbjct: 19 VKLPKTNLLAVMSDKGYIMCGALDVGLLNEKLGDRGIIAGRAVGVRTIEQLLEAPLESVT 78 Query: 61 IEAEKLGIVPGMTGADALLHM 81 IEAE LGI G G +ALL M Sbjct: 79 IEAEALGITAGTIGKEALLKM 99 >ref|NP_244319.1| BH3452~unknown conserved protein [Bacillus halodurans] pir||D84081 hypothetical protein BH3452 [imported] - Bacillus halodurans (strain C-125) dbj|BAB07171.1| BH3452~unknown conserved protein [Bacillus halodurans] Length = 100 Score = 113 bits (282), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 55/82 (67%), Positives = 66/82 (80%) Query: 1 VKLPKTTLLSISTGKGYIMCGALDVGLLNETLSDRGIIAARAVGVRTLPQLLAAPLESVT 60 +KLPKT +++++ KGYIMCGALDV LLNE L++R IIA RAVGVRT+ QLL APLESVT Sbjct: 19 LKLPKTNFMAVTSEKGYIMCGALDVALLNEKLAERKIIAGRAVGVRTIDQLLDAPLESVT 78 Query: 61 IEAEKLGIVPGMTGADALLHML 82 +EAE GI GM G DALL M+ Sbjct: 79 LEAEACGITEGMKGRDALLKMV 100 >ref|NP_834647.1| hypothetical protein [Bacillus cereus ATCC 14579] gb|AAP11848.1| hypothetical protein [Bacillus cereus ATCC 14579] Length = 100 Score = 113 bits (282), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 59/81 (72%), Positives = 64/81 (79%) Query: 1 VKLPKTTLLSISTGKGYIMCGALDVGLLNETLSDRGIIAARAVGVRTLPQLLAAPLESVT 60 VKLPKT LL++ + KGYIMCGALDVGLLNE L DRGIIA RAVGVRT+ QLL APLESVT Sbjct: 19 VKLPKTNLLAVMSDKGYIMCGALDVGLLNEKLGDRGIIAGRAVGVRTIEQLLEAPLESVT 78 Query: 61 IEAEKLGIVPGMTGADALLHM 81 AE LGI G G +ALL M Sbjct: 79 TGAEALGIPAGTIGKEALLKM 99 >ref|NP_391116.1| yunC [Bacillus subtilis] pir||F70015 hypothetical protein yunC - Bacillus subtilis emb|CAB15226.1| yunC [Bacillus subtilis subsp. subtilis str. 168] Length = 101 Score = 110 bits (275), Expect = 9e-24, Method: Compositional matrix adjust. Identities = 54/82 (65%), Positives = 64/82 (78%) Query: 1 VKLPKTTLLSISTGKGYIMCGALDVGLLNETLSDRGIIAARAVGVRTLPQLLAAPLESVT 60 VKLPKT ++++ GYIMCGALDV LLNE L +RGI+A RAVGVRT+ QLL APLESVT Sbjct: 19 VKLPKTNFMAVANDHGYIMCGALDVALLNEKLKERGIVAGRAVGVRTIDQLLDAPLESVT 78 Query: 61 IEAEKLGIVPGMTGADALLHML 82 AE LGI GM+G +ALL M+ Sbjct: 79 YAAEDLGIKVGMSGREALLKMM 100 >ref|NP_693293.1| hypothetical protein OB2372 [Oceanobacillus iheyensis HTE831] dbj|BAC14328.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 102 Score = 90.9 bits (224), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 2/83 (2%) Query: 1 VKLPKTTLLSISTGKGYIMCGALDVGLLNE--TLSDRGIIAARAVGVRTLPQLLAAPLES 58 V+LPKTTLL+IS GYIMC ALDV + NE L +R ++A RA+GVRT+ QLL APLE Sbjct: 19 VELPKTTLLTISNDVGYIMCAALDVDIFNEIPKLQERNVVAGRAMGVRTIDQLLHAPLEK 78 Query: 59 VTIEAEKLGIVPGMTGADALLHM 81 +T +++ G GMTG +ALL + Sbjct: 79 ITNASKEYGWEVGMTGKEALLKI 101 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.319 0.138 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 109,028,695 Number of extensions: 3458364 Number of successful extensions: 8348 Number of sequences better than 1.0e-05: 8 Number of HSP's gapped: 8348 Number of HSP's successfully gapped: 8 Length of query: 82 Length of database: 757,237,578 Length adjustment: 52 Effective length of query: 30 Effective length of database: 616,052,430 Effective search space: 18481572900 Effective search space used: 18481572900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)