BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0294.0009.p (140 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_653797.1| REC, cheY-homologous receiver domain [Bacillus ... 176 1e-43 pdb|1SRR|A Chain A, Crystal Structure Of A Phosphatase Resistant... 172 2e-42 ref|NP_391594.1| two-component response regulator [Bacillus subt... 171 4e-42 prf||2016360A spo0F gene 171 6e-42 pdb|1F51|E Chain E, A Transient Interaction Between Two Phosphor... 171 6e-42 >ref|NP_653797.1| REC, cheY-homologous receiver domain [Bacillus anthracis A2012] ref|NP_834998.1| Sporulation initiation phosphotransferase F [Bacillus cereus ATCC 14579] ref|NP_847737.1| stage 0 sporulation protein F [Bacillus anthracis str. Ames] ref|NP_981758.1| stage 0 sporulation protein F [Bacillus cereus ATCC 10987] gb|AAP12199.1| Sporulation initiation phosphotransferase F [Bacillus cereus ATCC 14579] gb|AAP29223.1| stage 0 sporulation protein F [Bacillus anthracis str. Ames] gb|AAS44366.1| stage 0 sporulation protein F [Bacillus cereus ATCC 10987] Length = 122 Score = 176 bits (446), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 86/115 (74%), Positives = 99/115 (86%) Query: 17 KVLIVDDQNGIRILLMEVFNSEGYATFQAANGKLALDIVRSESPDLVLLDMKIPGMDGLE 76 K+LIVDDQ GIR+LL EVF EGY TFQAANG ALDIV+ ++PDLV+LDMKIPGMDG+E Sbjct: 4 KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKDNPDLVVLDMKIPGMDGIE 63 Query: 77 ILKHLKEINPAIKVIMMTAYGELDMIKEATKLGALMHFTKPFDIDEMRIAVNMHL 131 ILKH+KEI+ +IKVI+MTAYGELDMI+EA LGALMHF KPFDIDE+R AV L Sbjct: 64 ILKHVKEIDESIKVILMTAYGELDMIQEAKDLGALMHFAKPFDIDEIRQAVRNEL 118 >pdb|1SRR|A Chain A, Crystal Structure Of A Phosphatase Resistant Mutant Of Sporulation Response Regulator Spo0f From Bacillus Subtilis pdb|1SRR|B Chain B, Crystal Structure Of A Phosphatase Resistant Mutant Of Sporulation Response Regulator Spo0f From Bacillus Subtilis pdb|1SRR|C Chain C, Crystal Structure Of A Phosphatase Resistant Mutant Of Sporulation Response Regulator Spo0f From Bacillus Subtilis Length = 124 Score = 172 bits (437), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 88/123 (71%), Positives = 101/123 (82%) Query: 13 MEKKKVLIVDDQNGIRILLMEVFNSEGYATFQAANGKLALDIVRSESPDLVLLDMKIPGM 72 M +K+LIVDDQ+GIRILL EVFN EGY TFQAANG ALDIV E PDLVLLDMKIPGM Sbjct: 1 MMNEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGM 60 Query: 73 DGLEILKHLKEINPAIKVIMMTAYGELDMIKEATKLGALMHFTKPFDIDEMRIAVNMHLN 132 DG+EILK +K I+ I+VI+MTAYGELDMI+E+ +LGAL HF KPFDIDE+R AV +L Sbjct: 61 DGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLP 120 Query: 133 NKS 135 KS Sbjct: 121 LKS 123 >ref|NP_391594.1| two-component response regulator [Bacillus subtilis] sp|P06628|SP0F_BACSU Sporulation initiation phosphotransferase F (Stage 0 sporulation protein F) pir||SZBS0F stage 0 sporulation protein spo0F - Bacillus subtilis pdb|1FSP| Nmr Solution Structure Of Bacillus Subtilis Spo0f Protein, 20 Structures pdb|2FSP| Nmr Solution Structure Of Bacillus Subtilis Spo0f Protein, Minimized Average Structure pdb|1NAT| Crystal Structure Of Spoof From Bacillus Subtilis pdb|1PUX|A Chain A, Nmr Solution Structure Of Bef3-Activated Spo0f, 20 Conformers emb|CAA27217.1| unnamed protein product [Bacillus subtilis] gb|AAA16802.1| spo0F gb|AAA22787.1| Spo0F protein emb|CAA89872.1| spo0F [Bacillus subtilis] emb|CAB15730.1| two-component response regulator [Bacillus subtilis subsp. subtilis str. 168] Length = 124 Score = 171 bits (434), Expect = 4e-42, Method: Compositional matrix adjust. Identities = 88/123 (71%), Positives = 100/123 (81%) Query: 13 MEKKKVLIVDDQNGIRILLMEVFNSEGYATFQAANGKLALDIVRSESPDLVLLDMKIPGM 72 M +K+LIVDDQ GIRILL EVFN EGY TFQAANG ALDIV E PDLVLLDMKIPGM Sbjct: 1 MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGM 60 Query: 73 DGLEILKHLKEINPAIKVIMMTAYGELDMIKEATKLGALMHFTKPFDIDEMRIAVNMHLN 132 DG+EILK +K I+ I+VI+MTAYGELDMI+E+ +LGAL HF KPFDIDE+R AV +L Sbjct: 61 DGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLP 120 Query: 133 NKS 135 KS Sbjct: 121 LKS 123 >prf||2016360A spo0F gene Length = 122 Score = 171 bits (432), Expect = 6e-42, Method: Compositional matrix adjust. Identities = 84/115 (73%), Positives = 96/115 (83%) Query: 17 KVLIVDDQNGIRILLMEVFNSEGYATFQAANGKLALDIVRSESPDLVLLDMKIPGMDGLE 76 K+LIVDDQ GIR+LL EVF EGY TFQAANG ALDIV+ ++PDLV+LDMKIPGMDG+E Sbjct: 4 KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKDNPDLVVLDMKIPGMDGIE 63 Query: 77 ILKHLKEINPAIKVIMMTAYGELDMIKEATKLGALMHFTKPFDIDEMRIAVNMHL 131 I K KEI+ +IKVI+MTAYGELDMI+EA LGALMHF KPFDIDE+R AV L Sbjct: 64 IFKACKEIDESIKVILMTAYGELDMIQEAKDLGALMHFAKPFDIDEIRQAVRNEL 118 >pdb|1F51|E Chain E, A Transient Interaction Between Two Phosphorelay Proteins Trapped In A Crystal Lattice Reveals The Mechanism Of Molecular Recognition And Phosphotransfer In Singal Transduction pdb|1F51|F Chain F, A Transient Interaction Between Two Phosphorelay Proteins Trapped In A Crystal Lattice Reveals The Mechanism Of Molecular Recognition And Phosphotransfer In Singal Transduction pdb|1F51|G Chain G, A Transient Interaction Between Two Phosphorelay Proteins Trapped In A Crystal Lattice Reveals The Mechanism Of Molecular Recognition And Phosphotransfer In Singal Transduction pdb|1F51|H Chain H, A Transient Interaction Between Two Phosphorelay Proteins Trapped In A Crystal Lattice Reveals The Mechanism Of Molecular Recognition And Phosphotransfer In Singal Transduction Length = 119 Score = 171 bits (432), Expect = 6e-42, Method: Compositional matrix adjust. Identities = 85/116 (73%), Positives = 98/116 (84%) Query: 16 KKVLIVDDQNGIRILLMEVFNSEGYATFQAANGKLALDIVRSESPDLVLLDMKIPGMDGL 75 +K+LIVDDQ+GIRILL EVFN EGY TFQAANG ALDIV E PDLVLLDMKIPGMDG+ Sbjct: 2 EKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGI 61 Query: 76 EILKHLKEINPAIKVIMMTAYGELDMIKEATKLGALMHFTKPFDIDEMRIAVNMHL 131 EILK +K I+ I+VI+MTAYGELDMI+E+ +LGAL HF KPFDIDE+R AV +L Sbjct: 62 EILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL 117 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.139 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 198,590,301 Number of extensions: 7164297 Number of successful extensions: 35274 Number of sequences better than 1.0e-05: 4928 Number of HSP's gapped: 34270 Number of HSP's successfully gapped: 4979 Length of query: 140 Length of database: 757,237,578 Length adjustment: 101 Effective length of query: 39 Effective length of database: 483,012,579 Effective search space: 18837490581 Effective search space used: 18837490581 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)