BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0291.0030.p (133 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_624011.1| conserved hypothetical protein [Thermoanaerobac... 76 2e-13 ref|ZP_00144685.1| hypothetical protein [Fusobacterium nucleatum... 64 1e-09 ref|NP_603251.1| Hypothetical protein [Fusobacterium nucleatum s... 61 9e-09 ref|NP_472117.1| lin2788 [Listeria innocua] >gi|25373760|pir||AF... 54 1e-06 ref|NP_466162.1| lmo2639 [Listeria monocytogenes EGD-e] >gi|2537... 54 1e-06 >ref|NP_624011.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis] gb|AAM25615.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis] Length = 126 Score = 76.3 bits (186), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 46/119 (38%), Positives = 72/119 (60%), Gaps = 11/119 (9%) Query: 1 MKRGDMILILVVLLVAGSL---YGIKAYKDHNEHYAQGELQAVITVDGKEYKTVSL--TK 55 MK+GD+ +IL V +++ L Y I A + ++ YA VI +DGK YK VSL Sbjct: 1 MKKGDIFIILFVAVLSVGLLVFYRISATQQYHHKYA------VIMIDGKVYKKVSLDDVN 54 Query: 56 EEQTIDIQTKFGHNILKVYDYGIRMTYSDAPLPIALDMGFISRPKQQILCVPARLMVEV 114 ++ I I TK G NIL V + G+++ +++ P I + GFI +P Q I+C+P R++VE+ Sbjct: 55 HKEEIPIVTKQGKNILLVKNGGVQVIHAECPDKICMKEGFIDKPGQSIVCLPFRIVVEI 113 >ref|ZP_00144685.1| hypothetical protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gb|EAA23720.1| hypothetical protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] Length = 130 Score = 63.5 bits (153), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 41/131 (31%), Positives = 73/131 (55%), Gaps = 10/131 (7%) Query: 1 MKRGDMIL-ILVVLLVAGSLYGIKAYKDHNEHYAQGELQAVITVDGKEYKTVSLTKEEQT 59 K GD+++ I +++ + ++ I ++KD A+ I VDG+ L KEE+ Sbjct: 7 FKIGDLVIYIFLIIFFSVLIFKIGSFKDIKGAKAE------IWVDGELKYVYPLQKEEKN 60 Query: 60 IDIQTKFGHNILKVYDYGIRMTYSDAPLPIALDMGFISRPKQQILCVPARLMVEVINPHR 119 I ++T G ++ D +R+T S++PL IA+ GFI P + I+ +P RL+V+VI Sbjct: 61 IFVETNLGGCNVQFKDNMVRVTTSNSPLKIAVKQGFIKSPGEVIIGIPDRLVVKVIGDSE 120 Query: 120 SINDDNELDAV 130 +D+++D V Sbjct: 121 ---NDSDIDFV 128 >ref|NP_603251.1| Hypothetical protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gb|AAL94550.1| Hypothetical protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] Length = 130 Score = 60.8 bits (146), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 40/131 (30%), Positives = 71/131 (54%), Gaps = 10/131 (7%) Query: 1 MKRGDMIL-ILVVLLVAGSLYGIKAYKDHNEHYAQGELQAVITVDGKEYKTVSLTKEEQT 59 K GD+++ + +++ + + I ++KD A+ I VDG+ L KEE+ Sbjct: 7 FKIGDLVIYVFLIIFFSILILKIGSFKDVKGAKAE------IWVDGELKYVYPLQKEEKN 60 Query: 60 IDIQTKFGHNILKVYDYGIRMTYSDAPLPIALDMGFISRPKQQILCVPARLMVEVINPHR 119 I ++T G ++ D +R+T S++PL IA+ GFI P + I+ +P RL+V+V+ Sbjct: 61 IFVETNLGGCNVQFKDNMVRVTTSNSPLKIAVKQGFIKSPGEVIIGIPDRLVVKVVGDSE 120 Query: 120 SINDDNELDAV 130 DD+ +D V Sbjct: 121 ---DDSGIDFV 128 >ref|NP_472117.1| lin2788 [Listeria innocua] pir||AF1780 hypothetical protein lin2788 [imported] - Listeria innocua (strain Clip11262) emb|CAC98014.1| lin2788 [Listeria innocua] Length = 144 Score = 53.5 bits (127), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 3/85 (3%) Query: 33 AQGELQAVITVDGKEYKTVSLT--KEEQTIDIQTKFGH-NILKVYDYGIRMTYSDAPLPI 89 + EL AVI+VD KEYKTV+LT K ++ D++ GH N ++V IR++ ++ + Sbjct: 43 GKKELVAVISVDSKEYKTVTLTGHKGTESFDVKQPDGHTNTIEVSGEEIRISKANCNDQV 102 Query: 90 ALDMGFISRPKQQILCVPARLMVEV 114 + G I + ++C+P +L++EV Sbjct: 103 CVRTGAIDKQGDTVVCLPHKLVIEV 127 >ref|NP_466162.1| lmo2639 [Listeria monocytogenes EGD-e] pir||AG1404 hypothetical protein lmo2639 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAD00717.1| lmo2639 [Listeria monocytogenes] Length = 144 Score = 53.5 bits (127), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 3/85 (3%) Query: 33 AQGELQAVITVDGKEYKTVSLT--KEEQTIDIQTKFGH-NILKVYDYGIRMTYSDAPLPI 89 + EL AVI+VD KEYKTV+LT K ++ D++ GH N ++V IR++ ++ + Sbjct: 43 GKKELVAVISVDNKEYKTVTLTGHKGTESFDVKQPDGHTNTIEVSGEEIRISKANCNDQV 102 Query: 90 ALDMGFISRPKQQILCVPARLMVEV 114 + G I + ++C+P +L++EV Sbjct: 103 CVRTGAIDKQGDTVVCLPHKLVIEV 127 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 189,590,613 Number of extensions: 6944954 Number of successful extensions: 16045 Number of sequences better than 1.0e-05: 6 Number of HSP's gapped: 16048 Number of HSP's successfully gapped: 6 Length of query: 133 Length of database: 757,237,578 Length adjustment: 95 Effective length of query: 38 Effective length of database: 499,303,173 Effective search space: 18973520574 Effective search space used: 18973520574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)