BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0291.0024.p (45 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_658372.1| Ribosomal_L33, Ribosomal protein L33 [Bacillus ... 74 8e-13 ref|NP_371859.1| 50S ribosomal protein L33 [Staphylococcus aureu... 74 1e-12 ref|NP_764572.1| 50S ribosomal protein L33 [Staphylococcus epide... 74 1e-12 sp|Q8CSP9|R332_STAEP 50S ribosomal protein L33 type 2 73 2e-12 ref|NP_692846.1| 50S ribosomal protein L33 [Oceanobacillus iheye... 73 2e-12 >ref|NP_658372.1| Ribosomal_L33, Ribosomal protein L33 [Bacillus anthracis A2012] ref|NP_834051.1| LSU ribosomal protein L33P [Bacillus cereus ATCC 14579] ref|NP_846792.1| ribosomal protein L33 [Bacillus anthracis str. Ames] ref|NP_980717.1| ribosomal protein L33 [Bacillus cereus ATCC 10987] gb|AAP11252.1| LSU ribosomal protein L33P [Bacillus cereus ATCC 14579] gb|AAP28278.1| ribosomal protein L33 [Bacillus anthracis str. Ames] gb|AAS43325.1| ribosomal protein L33 [Bacillus cereus ATCC 10987] Length = 49 Score = 74.3 bits (181), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 33/45 (73%), Positives = 39/45 (86%) Query: 1 VTLACTETGDRNYTTTKNKKNQPGRLEMKKYSPRLKRVTLHRETR 45 +TLACTE GDRNY + KNK+N P R+E+KKY PRLKRVTLHRET+ Sbjct: 5 ITLACTECGDRNYISKKNKRNNPERIELKKYCPRLKRVTLHRETK 49 >ref|NP_371859.1| 50S ribosomal protein L33 [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374449.1| 50S ribosomal protein L33 [Staphylococcus aureus subsp. aureus N315] ref|NP_646039.1| 50S ribosomal protein L33 [Staphylococcus aureus subsp. aureus MW2] sp|Q99UE1|R332_STAAM 50S ribosomal protein L33 type 2 pir||H89908 50S ribosomal protein L33 [imported] - Staphylococcus aureus (strain N315) dbj|BAB42428.1| 50S ribosomal protein L33 [Staphylococcus aureus subsp. aureus N315] dbj|BAB57497.1| 50S ribosomal protein L33 [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB95087.1| 50S ribosomal protein L33 [Staphylococcus aureus subsp. aureus MW2] Length = 49 Score = 73.6 bits (179), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 34/45 (75%), Positives = 38/45 (84%) Query: 1 VTLACTETGDRNYTTTKNKKNQPGRLEMKKYSPRLKRVTLHRETR 45 VTLACTE GDRNY TTKNK+N P R+EMKKY PRL + TLHRET+ Sbjct: 5 VTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK 49 >ref|NP_764572.1| 50S ribosomal protein L33 [Staphylococcus epidermidis ATCC 12228] gb|AAO04614.1| 50S ribosomal protein L33 [Staphylococcus epidermidis ATCC 12228] Length = 52 Score = 73.6 bits (179), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 33/45 (73%), Positives = 38/45 (84%) Query: 1 VTLACTETGDRNYTTTKNKKNQPGRLEMKKYSPRLKRVTLHRETR 45 +TLACTE GDRNY TTKNK+N P R+EMKKY PRL + TLHRET+ Sbjct: 8 ITLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK 52 >sp|Q8CSP9|R332_STAEP 50S ribosomal protein L33 type 2 Length = 49 Score = 73.2 bits (178), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/45 (73%), Positives = 38/45 (84%) Query: 1 VTLACTETGDRNYTTTKNKKNQPGRLEMKKYSPRLKRVTLHRETR 45 +TLACTE GDRNY TTKNK+N P R+EMKKY PRL + TLHRET+ Sbjct: 5 ITLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRETK 49 >ref|NP_692846.1| 50S ribosomal protein L33 [Oceanobacillus iheyensis HTE831] dbj|BAC13881.1| 50S ribosomal protein L33 [Oceanobacillus iheyensis HTE831] Length = 49 Score = 73.2 bits (178), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/45 (73%), Positives = 40/45 (88%) Query: 1 VTLACTETGDRNYTTTKNKKNQPGRLEMKKYSPRLKRVTLHRETR 45 +TLACTETGDRNY +TKNK+ P R+E+KKYSPRLK+ TLHRET+ Sbjct: 5 ITLACTETGDRNYISTKNKRTNPERIELKKYSPRLKKHTLHRETK 49 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.313 0.126 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 67,638,749 Number of extensions: 1580514 Number of successful extensions: 2797 Number of sequences better than 1.0e-05: 54 Number of HSP's gapped: 2808 Number of HSP's successfully gapped: 54 Length of query: 45 Length of database: 757,237,578 Length adjustment: 18 Effective length of query: 27 Effective length of database: 708,365,796 Effective search space: 19125876492 Effective search space used: 19125876492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)