BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0291.0012.p (95 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00080581.1| hypothetical protein [Geobacter metallireducens] 102 3e-21 ref|NP_954012.1| conserved hypothetical protein [Geobacter sulfu... 96 3e-19 ref|NP_988007.1| conserved hypothetical protein [Methanococcus m... 72 4e-12 ref|NP_561769.1| hypothetical protein [Clostridium perfringens] ... 69 2e-11 ref|NP_347155.1| Uncharacterized conserved protein [Clostridium ... 69 4e-11 >ref|ZP_00080581.1| hypothetical protein [Geobacter metallireducens] Length = 97 Score = 102 bits (253), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 53/95 (55%), Positives = 64/95 (67%), Gaps = 1/95 (1%) Query: 1 MIKHIVFFKLKDRAPEKVQETVAVLRNMEGKIPQLLSIEVGADIIRSERSFDIALVTVVA 60 M+ HIVFFKL D P V T L +M G+IP L +EVG D+IRSERS+D+ALVT Sbjct: 1 MVTHIVFFKLHDPTPANVTATREKLESMRGEIPLLRHLEVGVDVIRSERSYDLALVTKFD 60 Query: 61 SLDDLQAYQVHPEH-KKVIAHINEVKEVSYAVDYE 94 S++DLQAYQVHP H +VI H+ V AVDYE Sbjct: 61 SMEDLQAYQVHPYHAGEVIPHMKAVSSSVVAVDYE 95 >ref|NP_954012.1| conserved hypothetical protein [Geobacter sulfurreducens PCA] gb|AAR36362.1| conserved hypothetical protein [Geobacter sulfurreducens PCA] Length = 96 Score = 95.9 bits (237), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 52/95 (54%), Positives = 62/95 (65%), Gaps = 1/95 (1%) Query: 1 MIKHIVFFKLKDRAPEKVQETVAVLRNMEGKIPQLLSIEVGADIIRSERSFDIALVTVVA 60 MI HIVFFKL D + + T L +M GK+P L IEVG D+IRSERS+D+ALVT Sbjct: 1 MITHIVFFKLTDPSAPTIAATREKLESMRGKVPLLRHIEVGVDVIRSERSYDLALVTRFD 60 Query: 61 SLDDLQAYQVHPEH-KKVIAHINEVKEVSYAVDYE 94 SL DLQAYQV P H +V+ H+ V AVDYE Sbjct: 61 SLADLQAYQVDPYHAGEVVPHMKSVCSSIVAVDYE 95 >ref|NP_988007.1| conserved hypothetical protein [Methanococcus maripaludis S2] emb|CAF30443.1| conserved hypothetical protein [Methanococcus maripaludis] Length = 100 Score = 72.0 bits (175), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 5/100 (5%) Query: 1 MIKHIVFFKLK--DRAPEKVQETVAV---LRNMEGKIPQLLSIEVGADIIRSERSFDIAL 55 MIKHIV +KLK D+ +K + + L ++ G IP++ IEVG + + E ++D+ L Sbjct: 1 MIKHIVMWKLKENDKDNDKFENAKTIKNKLESLNGVIPEIKYIEVGVNSEKFENNYDVVL 60 Query: 56 VTVVASLDDLQAYQVHPEHKKVIAHINEVKEVSYAVDYEI 95 V+ S +DL YQ HPEH KV + V E+ AVDYE Sbjct: 61 VSEFDSFEDLDIYQKHPEHVKVGKFVKSVAEIRTAVDYEF 100 >ref|NP_561769.1| hypothetical protein [Clostridium perfringens] dbj|BAB80559.1| hypothetical protein [Clostridium perfringens str. 13] Length = 100 Score = 69.3 bits (168), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 37/100 (37%), Positives = 62/100 (62%), Gaps = 5/100 (5%) Query: 1 MIKHIVFFKLKDRAPEKVQ-ETVAVLRN----MEGKIPQLLSIEVGADIIRSERSFDIAL 55 MIKHIV +KLKD A + E +++N ++ KI +++ +EVG D+ +SE+++D+ L Sbjct: 1 MIKHIVMWKLKDEAEGNSKAENAKIIKNSLEDLKEKINEIVHLEVGIDVNKSEQAYDVVL 60 Query: 56 VTVVASLDDLQAYQVHPEHKKVIAHINEVKEVSYAVDYEI 95 + SL+DL +YQ +P+H K + +V VDYE+ Sbjct: 61 YSTFNSLEDLDSYQKNPDHVKAGYFVKKVASSRVVVDYEV 100 >ref|NP_347155.1| Uncharacterized conserved protein [Clostridium acetobutylicum] pir||D96963 uncharacterized conserved protein CAC0515 [imported] - Clostridium acetobutylicum gb|AAK78495.1| Uncharacterized conserved protein [Clostridium acetobutylicum] Length = 94 Score = 68.9 bits (167), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 37/95 (38%), Positives = 61/95 (64%), Gaps = 3/95 (3%) Query: 1 MIKHIVFFKLKDRAPEKVQETVAVLRNMEGKIPQLLSIEVGADIIRSERSFDIALVTVVA 60 M+ HIVFFKL D+ + V + +L ++EG + ++VG D++ S+R++DIAL+ Sbjct: 1 MLTHIVFFKLHDK--KDVGKVKQILESIEGNVEFARKVKVGIDVVHSKRAYDIALIVKFD 58 Query: 61 SLDDLQAYQVHPEH-KKVIAHINEVKEVSYAVDYE 94 SL D++ YQVHP H VI + ++ + S +VD+E Sbjct: 59 SLKDMETYQVHPYHVDVVIKNTKDLIQSSVSVDFE 93 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.136 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 123,234,401 Number of extensions: 3806483 Number of successful extensions: 11745 Number of sequences better than 1.0e-05: 12 Number of HSP's gapped: 11743 Number of HSP's successfully gapped: 12 Length of query: 95 Length of database: 757,237,578 Length adjustment: 63 Effective length of query: 32 Effective length of database: 586,186,341 Effective search space: 18757962912 Effective search space used: 18757962912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)