BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0280.0017.p (80 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_243256.1| BH2390~unknown conserved protein in B. subtilis... 79 3e-14 ref|NP_389570.1| similar to hypothetical proteins from B. subtil... 78 7e-14 ref|NP_692540.1| hypothetical protein OB1619 [Oceanobacillus ihe... 75 4e-13 ref|NP_657751.1| hypothetical protein predicted by GeneMark [Bac... 73 2e-12 ref|NP_833507.1| IG hypothetical 16623 [Bacillus cereus ATCC 145... 72 4e-12 >ref|NP_243256.1| BH2390~unknown conserved protein in B. subtilis [Bacillus halodurans] pir||F83948 hypothetical protein BH2390 [imported] - Bacillus halodurans (strain C-125) dbj|BAB06109.1| BH2390~unknown conserved protein in B. subtilis [Bacillus halodurans] Length = 84 Score = 79.0 bits (193), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 33/77 (42%), Positives = 55/77 (71%) Query: 3 NFDTWKSFLGERVIQAEKMGMSEETISKLAFEIGEFLDKKVDPGNYSNRAIKELWDVGTD 62 N++ WK FLG+R+ QAE GM++ IS +A+++GE+L K+V+P N R + +LW V + Sbjct: 6 NWEQWKDFLGDRLQQAESEGMNDGVISDVAYQVGEYLAKQVEPQNEQERILADLWKVANE 65 Query: 63 DEKQTIASLMVKLAKKN 79 +E+ IA++MVKL + + Sbjct: 66 EEQHAIANMMVKLVRSD 82 >ref|NP_389570.1| similar to hypothetical proteins from B. subtilis [Bacillus subtilis] pir||A69886 conserved hypothetical protein ymfJ - Bacillus subtilis emb|CAB13561.1| ymfJ [Bacillus subtilis subsp. subtilis str. 168] Length = 85 Score = 77.8 bits (190), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 34/80 (42%), Positives = 57/80 (71%) Query: 1 VKNFDTWKSFLGERVIQAEKMGMSEETISKLAFEIGEFLDKKVDPGNYSNRAIKELWDVG 60 ++N+D+WK+FLG+R+ A+ GMS++TI+ LA EIG +L +V+ N + + +LW V Sbjct: 4 LENWDSWKNFLGDRLNYAQDKGMSQDTITDLATEIGSYLANEVESKNEQEKVLADLWSVA 63 Query: 61 TDDEKQTIASLMVKLAKKNA 80 + DE+ IA++MVKL + N+ Sbjct: 64 SKDEQHAIANMMVKLVENNS 83 >ref|NP_692540.1| hypothetical protein OB1619 [Oceanobacillus iheyensis HTE831] dbj|BAC13575.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 82 Score = 75.1 bits (183), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 32/76 (42%), Positives = 54/76 (71%) Query: 3 NFDTWKSFLGERVIQAEKMGMSEETISKLAFEIGEFLDKKVDPGNYSNRAIKELWDVGTD 62 NFD+WK FL +R+ QA+ G+ ++TIS LA E+G++L + V+ N +KELW+ ++ Sbjct: 6 NFDSWKGFLADRLEQAQANGVDQKTISGLAAEVGDYLAQSVNAQNPEEEVLKELWNAASE 65 Query: 63 DEKQTIASLMVKLAKK 78 +E+Q +A+ M+KL +K Sbjct: 66 EEQQALANTMIKLVQK 81 >ref|NP_657751.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_846167.1| conserved hypothetical protein [Bacillus anthracis str. Ames] ref|NP_980116.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAP27653.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAS42724.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 82 Score = 72.8 bits (177), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 50/78 (64%) Query: 1 VKNFDTWKSFLGERVIQAEKMGMSEETISKLAFEIGEFLDKKVDPGNYSNRAIKELWDVG 60 + NFD WKSFLGER+ QA+ G+ +S +AF +G++L +V+ N + + ELW V Sbjct: 4 LDNFDQWKSFLGERLEQAQGKGLDGGAVSDMAFRVGDYLANEVEARNDQEKLLAELWKVA 63 Query: 61 TDDEKQTIASLMVKLAKK 78 + E+ TIA+LMVK + Sbjct: 64 DEQEQHTIANLMVKFVQH 81 >ref|NP_833507.1| IG hypothetical 16623 [Bacillus cereus ATCC 14579] gb|AAP10708.1| IG hypothetical 16623 [Bacillus cereus ATCC 14579] Length = 81 Score = 72.0 bits (175), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 33/77 (42%), Positives = 50/77 (64%) Query: 1 VKNFDTWKSFLGERVIQAEKMGMSEETISKLAFEIGEFLDKKVDPGNYSNRAIKELWDVG 60 + NFD WKSFLGER+ QA+ G+ +S +AF +G++L +V+ N + + ELW V Sbjct: 4 LDNFDQWKSFLGERLEQAQDKGLDGGAVSDMAFRVGDYLANEVEGRNDQEKLLAELWKVA 63 Query: 61 TDDEKQTIASLMVKLAK 77 + E+ TIA+LMVK + Sbjct: 64 DEQEQHTIANLMVKFVQ 80 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.313 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 116,166,011 Number of extensions: 3831433 Number of successful extensions: 7972 Number of sequences better than 1.0e-05: 6 Number of HSP's gapped: 7972 Number of HSP's successfully gapped: 6 Length of query: 80 Length of database: 757,237,578 Length adjustment: 50 Effective length of query: 30 Effective length of database: 621,482,628 Effective search space: 18644478840 Effective search space used: 18644478840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)