BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0269.0008.p (139 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00066972.1| COG1172: Ribose/xylose/arabinose/galactoside ... 83 2e-15 ref|NP_437569.1| putative sugar uptake ABC transporter permease ... 82 3e-15 ref|NP_769842.1| sugar ABC transporter permease protein [Bradyrh... 81 8e-15 ref|NP_407351.1| putative sugar transport system permease [Yersi... 81 8e-15 ref|NP_357380.1| AGR_L_3181p [Agrobacterium tumefaciens] >gi|179... 79 3e-14 >ref|ZP_00066972.1| COG1172: Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Microbulbifer degradans 2-40] Length = 340 Score = 82.8 bits (203), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 39/68 (57%), Positives = 54/68 (79%) Query: 23 SPDFFSITVHDGHLYGSLIDILNFGAPLILVAIGMTLVVATKGIDLSVGSIVAISGAIAC 82 +P+FF + + DG +YGSLID+LN AP+ L+AIGMTLV+AT G+DLSVGS++AI+GA++ Sbjct: 31 APEFFQLEIKDGRIYGSLIDVLNRAAPVALLAIGMTLVIATGGVDLSVGSVMAIAGAVSA 90 Query: 83 LSISRGAD 90 I G D Sbjct: 91 SLIVAGVD 98 >ref|NP_437569.1| putative sugar uptake ABC transporter permease protein [Sinorhizobium meliloti 1021] pir||E95970 probable sugar uptake ABC transporter permease protein SMb21589 [imported] - Sinorhizobium meliloti (strain 1021) magaplasmid pSymB emb|CAC49429.1| putative sugar uptake ABC transporter permease protein [Sinorhizobium meliloti] Length = 341 Score = 82.4 bits (202), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 38/65 (58%), Positives = 54/65 (83%) Query: 24 PDFFSITVHDGHLYGSLIDILNFGAPLILVAIGMTLVVATKGIDLSVGSIVAISGAIACL 83 P F ++ + +G LYGS++DILN GAP++L+AIGMT+V+ATKGIDLSVG+++AI GA+A Sbjct: 31 PGFLNLQIQNGRLYGSMVDILNRGAPVVLLAIGMTVVIATKGIDLSVGAVMAICGAVAAS 90 Query: 84 SISRG 88 I+ G Sbjct: 91 LITSG 95 >ref|NP_769842.1| sugar ABC transporter permease protein [Bradyrhizobium japonicum] dbj|BAC48467.1| sugar ABC transporter permease protein [Bradyrhizobium japonicum USDA 110] Length = 330 Score = 80.9 bits (198), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 38/60 (63%), Positives = 50/60 (83%) Query: 23 SPDFFSITVHDGHLYGSLIDILNFGAPLILVAIGMTLVVATKGIDLSVGSIVAISGAIAC 82 SP FF + + DG L+GSLID+LN G P+ L+++GM LV+AT+GIDLSVG+I+AISGAIA Sbjct: 27 SPQFFDLRLQDGRLFGSLIDVLNRGTPVALLSLGMVLVIATRGIDLSVGAIMAISGAIAA 86 >ref|NP_407351.1| putative sugar transport system permease [Yersinia pestis] ref|NP_667670.1| putative ABC transport system inner membrane permease protein [Yersinia pestis KIM] ref|NP_994435.1| putative sugar transport system permease [Yersinia pestis biovar Mediaevails str. 91001] pir||AH0475 probable sugar transport system permease YPO3906 [imported] - Yersinia pestis (strain CO92) emb|CAC93372.1| putative sugar transport system permease [Yersinia pestis CO92] gb|AAM83921.1| putative ABC transport system inner membrane permease protein [Yersinia pestis KIM] gb|AAS63312.1| putative sugar transport system permease [Yersinia pestis biovar Mediaevails str. 91001] Length = 339 Score = 80.9 bits (198), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 41/66 (62%), Positives = 53/66 (80%) Query: 23 SPDFFSITVHDGHLYGSLIDILNFGAPLILVAIGMTLVVATKGIDLSVGSIVAISGAIAC 82 +P FFSI + DG L+GS+IDILN GAP+ L+A+GMTLV+AT GIDLSVG+++AI+GA A Sbjct: 40 APHFFSIHIQDGRLFGSIIDILNRGAPVALLALGMTLVIATGGIDLSVGAVMAIAGATAA 99 Query: 83 LSISRG 88 S G Sbjct: 100 TLTSAG 105 >ref|NP_357380.1| AGR_L_3181p [Agrobacterium tumefaciens] ref|NP_533724.1| ABC transporter, membrane spanning protein [ribose] [Agrobacterium tumefaciens str. C58 (U. Washington)] pir||C98330 hypothetical protein AGR_L_3181 [imported] - Agrobacterium tumefaciens (strain C58, Cereon) pir||AB2953 hypothetical protein Atu3224 [imported] - Agrobacterium tumefaciens (strain C58, Dupont) gb|AAK90165.1| AGR_L_3181p [Agrobacterium tumefaciens str. C58 (Cereon)] gb|AAL44040.1| ABC transporter, membrane spanning protein [ribose] [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 348 Score = 79.0 bits (193), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 39/66 (59%), Positives = 51/66 (77%) Query: 23 SPDFFSITVHDGHLYGSLIDILNFGAPLILVAIGMTLVVATKGIDLSVGSIVAISGAIAC 82 SP F +++ +G LYGSLIDIL AP+ L+ IGMTLV+ATKGIDLS+G+++AI GA+A Sbjct: 30 SPGFLDVSLQNGRLYGSLIDILVRAAPVALLTIGMTLVIATKGIDLSIGAVIAICGAVAA 89 Query: 83 LSISRG 88 IS G Sbjct: 90 TLISNG 95 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.322 0.141 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 152,418,127 Number of extensions: 4480687 Number of successful extensions: 11329 Number of sequences better than 1.0e-05: 36 Number of HSP's gapped: 11331 Number of HSP's successfully gapped: 36 Length of query: 139 Length of database: 757,237,578 Length adjustment: 100 Effective length of query: 39 Effective length of database: 485,727,678 Effective search space: 18943379442 Effective search space used: 18943379442 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)