BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0265.0013.p (67 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_834112.1| D-tyrosyl-tRNA(Tyr) deacylase [Bacillus cereus ... 80 2e-14 ref|NP_980783.1| D-tyrosyl-tRNA(Tyr) deacylase [Bacillus cereus ... 80 2e-14 ref|NP_658434.1| DUF154, Uncharacterized ACR, COG1490 [Bacillus ... 78 7e-14 ref|NP_213302.1| hypothetical protein [Aquifex aeolicus] >gi|201... 74 1e-12 ref|ZP_00179723.1| hypothetical protein Cwat062201 [Crocosphaera... 73 2e-12 >ref|NP_834112.1| D-tyrosyl-tRNA(Tyr) deacylase [Bacillus cereus ATCC 14579] sp|Q817X5|DTD_BACCR D-tyrosyl-tRNA(Tyr) deacylase gb|AAP11313.1| D-tyrosyl-tRNA(Tyr) deacylase [Bacillus cereus ATCC 14579] Length = 146 Score = 79.7 bits (195), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 37/62 (59%), Positives = 45/62 (72%) Query: 5 AKAGGRTXXXXAAGPAEAERLYDYFNQELRNGGLQVETGVFGAMMDVSLTNWGPVTLLLD 64 + G R AA P AERLYD+FN+E+R GL VETG FGAMMDVSL N GPVTL+++ Sbjct: 85 CRKGRRPNFMDAAKPDYAERLYDFFNEEVRKQGLHVETGKFGAMMDVSLINDGPVTLIVE 144 Query: 65 SR 66 S+ Sbjct: 145 SK 146 >ref|NP_980783.1| D-tyrosyl-tRNA(Tyr) deacylase [Bacillus cereus ATCC 10987] gb|AAS43391.1| D-tyrosyl-tRNA(Tyr) deacylase [Bacillus cereus ATCC 10987] Length = 146 Score = 79.7 bits (195), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 37/62 (59%), Positives = 45/62 (72%) Query: 5 AKAGGRTXXXXAAGPAEAERLYDYFNQELRNGGLQVETGVFGAMMDVSLTNWGPVTLLLD 64 + G R AA P AERLYD+FN+E+R GL VETG FGAMMDVSL N GPVTL+++ Sbjct: 85 CRKGRRPNFMDAAKPDYAERLYDFFNEEVRKQGLHVETGKFGAMMDVSLINDGPVTLIVE 144 Query: 65 SR 66 S+ Sbjct: 145 SK 146 >ref|NP_658434.1| DUF154, Uncharacterized ACR, COG1490 [Bacillus anthracis A2012] ref|NP_846853.1| D-tyrosyl-tRNA(Tyr) deacylase [Bacillus anthracis str. Ames] sp|Q81LI3|DTD_BACAA D-tyrosyl-tRNA(Tyr) deacylase gb|AAP28339.1| D-tyrosyl-tRNA(Tyr) deacylase [Bacillus anthracis str. Ames] Length = 146 Score = 77.8 bits (190), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 36/62 (58%), Positives = 44/62 (70%) Query: 5 AKAGGRTXXXXAAGPAEAERLYDYFNQELRNGGLQVETGVFGAMMDVSLTNWGPVTLLLD 64 + G R AA P AE LYD+FN+E+R GL VETG FGAMMDVSL N GPVTL+++ Sbjct: 85 CRKGRRPNFMDAAKPDYAEHLYDFFNEEVRKQGLHVETGKFGAMMDVSLINDGPVTLIVE 144 Query: 65 SR 66 S+ Sbjct: 145 SK 146 >ref|NP_213302.1| hypothetical protein [Aquifex aeolicus] sp|O66742|DTD_AQUAE D-tyrosyl-tRNA(Tyr) deacylase pir||B70339 conserved hypothetical protein aq_428 - Aquifex aeolicus gb|AAC06704.1| hypothetical protein [Aquifex aeolicus VF5] Length = 148 Score = 73.6 bits (179), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 31/62 (50%), Positives = 42/62 (67%) Query: 5 AKAGGRTXXXXAAGPAEAERLYDYFNQELRNGGLQVETGVFGAMMDVSLTNWGPVTLLLD 64 K G R A P A+ LY+ F +++ GL+VETG+FGAMMDV + NWGPVT+++D Sbjct: 85 VKKGRRPSFEEAEEPKRAKELYEKFVDKIKESGLKVETGIFGAMMDVFIENWGPVTIIID 144 Query: 65 SR 66 SR Sbjct: 145 SR 146 >ref|ZP_00179723.1| hypothetical protein Cwat062201 [Crocosphaera watsonii WH 8501] Length = 119 Score = 72.8 bits (177), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/60 (55%), Positives = 45/60 (75%) Query: 5 AKAGGRTXXXXAAGPAEAERLYDYFNQELRNGGLQVETGVFGAMMDVSLTNWGPVTLLLD 64 + G R +A PAEAE+LY+ F ++L+ GL+VETG+FGAMM+VS+ N GPVTLLL+ Sbjct: 57 CRQGRRPSFSNSAPPAEAEKLYNLFVEQLKKSGLKVETGIFGAMMEVSINNDGPVTLLLE 116 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 88,997,619 Number of extensions: 2481672 Number of successful extensions: 4310 Number of sequences better than 1.0e-05: 62 Number of HSP's gapped: 4327 Number of HSP's successfully gapped: 62 Length of query: 67 Length of database: 757,237,578 Length adjustment: 38 Effective length of query: 29 Effective length of database: 654,063,816 Effective search space: 18967850664 Effective search space used: 18967850664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 120 (50.8 bits)