BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0265.0005.p (78 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_242896.1| BH2030~unknown conserved protein [Bacillus halo... 100 1e-20 ref|NP_980445.1| xanthine/uracil permease family protein [Bacill... 96 3e-19 ref|NP_833801.1| Guanine-hypoxanthine permease [Bacillus cereus ... 96 3e-19 ref|NP_658123.1| xan_ur_permease, Permease family [Bacillus anth... 95 4e-19 ref|NP_683127.1| ORF_ID:tlr2337~hypothetical protein [Thermosyne... 89 4e-17 >ref|NP_242896.1| BH2030~unknown conserved protein [Bacillus halodurans] pir||F83903 hypothetical protein BH2030 [imported] - Bacillus halodurans (strain C-125) dbj|BAB05749.1| BH2030~unknown conserved protein [Bacillus halodurans] Length = 432 Score = 100 bits (248), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 47/76 (61%), Positives = 58/76 (76%) Query: 1 MVQNVREMDLSDLTELFPAFLIMVMIPFTYSIVDGMAFGFITYPVVKLAMGKGKEVPPAL 60 MVQ V+++D D +E FPAFL++VMIPF+YSI DG+AFGFI YP+VK A+GK KEVP L Sbjct: 357 MVQQVKQIDFQDFSEGFPAFLVIVMIPFSYSIADGIAFGFIAYPLVKFALGKAKEVPIPL 416 Query: 61 YGIAGLFIANFVLHAF 76 Y IA LF FV H + Sbjct: 417 YVIATLFFLTFVAHVY 432 >ref|NP_980445.1| xanthine/uracil permease family protein [Bacillus cereus ATCC 10987] gb|AAS43053.1| xanthine/uracil permease family protein [Bacillus cereus ATCC 10987] Length = 429 Score = 95.9 bits (237), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 44/73 (60%), Positives = 60/73 (82%) Query: 3 QNVREMDLSDLTELFPAFLIMVMIPFTYSIVDGMAFGFITYPVVKLAMGKGKEVPPALYG 62 +++++ L+D +E FPAFLI+VMIP TYSI DG+AFGFI YP++K+A+GK KEV P++Y Sbjct: 355 TSIQQIPLNDFSEGFPAFLIIVMIPLTYSIADGIAFGFIAYPILKVALGKRKEVAPSMYI 414 Query: 63 IAGLFIANFVLHA 75 I LF+A FVLHA Sbjct: 415 ITCLFLAMFVLHA 427 >ref|NP_833801.1| Guanine-hypoxanthine permease [Bacillus cereus ATCC 14579] gb|AAP11002.1| Guanine-hypoxanthine permease [Bacillus cereus ATCC 14579] Length = 429 Score = 95.9 bits (237), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 44/73 (60%), Positives = 60/73 (82%) Query: 3 QNVREMDLSDLTELFPAFLIMVMIPFTYSIVDGMAFGFITYPVVKLAMGKGKEVPPALYG 62 +++++ L+D +E FPAFLI+VMIP TYSI DG+AFGFI YP++K+A+GK KEV P++Y Sbjct: 355 TSIQQIPLNDFSEGFPAFLIIVMIPLTYSIADGIAFGFIAYPILKVALGKRKEVAPSMYI 414 Query: 63 IAGLFIANFVLHA 75 I LF+A FVLHA Sbjct: 415 ITCLFLAMFVLHA 427 >ref|NP_658123.1| xan_ur_permease, Permease family [Bacillus anthracis A2012] ref|NP_846538.1| xanthine/uracil permease family protein [Bacillus anthracis str. Ames] gb|AAP28024.1| xanthine/uracil permease family protein [Bacillus anthracis str. Ames] Length = 429 Score = 95.1 bits (235), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 43/73 (58%), Positives = 60/73 (82%) Query: 3 QNVREMDLSDLTELFPAFLIMVMIPFTYSIVDGMAFGFITYPVVKLAMGKGKEVPPALYG 62 +++++ L+D +E FPAFLI++MIP TYSI DG+AFGFI YP++K+A+GK KEV P++Y Sbjct: 355 TSIQQIPLNDFSEGFPAFLIIIMIPLTYSIADGIAFGFIAYPILKVALGKRKEVAPSMYI 414 Query: 63 IAGLFIANFVLHA 75 I LF+A FVLHA Sbjct: 415 ITCLFLAMFVLHA 427 >ref|NP_683127.1| ORF_ID:tlr2337~hypothetical protein [Thermosynechococcus elongatus BP-1] dbj|BAC09889.1| ORF_ID:tlr2337~hypothetical protein [Thermosynechococcus elongatus BP-1] Length = 413 Score = 88.6 bits (218), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 38/71 (53%), Positives = 58/71 (81%) Query: 1 MVQNVREMDLSDLTELFPAFLIMVMIPFTYSIVDGMAFGFITYPVVKLAMGKGKEVPPAL 60 M +++ E+ SDLTE PAFL+M+++P +YSI +G+ GFI+YP+VKLA GKG+EV PAL Sbjct: 340 MARSLPEIPWSDLTEAIPAFLVMLVMPLSYSISEGLGVGFISYPIVKLAAGKGREVHPAL 399 Query: 61 YGIAGLFIANF 71 +G+A +F+A++ Sbjct: 400 WGLAVIFVAHY 410 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.332 0.147 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 105,904,411 Number of extensions: 3419282 Number of successful extensions: 10149 Number of sequences better than 1.0e-05: 353 Number of HSP's gapped: 10150 Number of HSP's successfully gapped: 353 Length of query: 78 Length of database: 757,237,578 Length adjustment: 48 Effective length of query: 30 Effective length of database: 626,912,826 Effective search space: 18807384780 Effective search space used: 18807384780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 120 (50.8 bits)