BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0264.0019.p (197 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P41007|PYRR_BACCL PyrR bifunctional protein [Includes: Pyrimi... 226 2e-58 ref|NP_243407.1| transcriptional attenuation of the pyrimidine o... 222 3e-57 ref|NP_657861.1| Pribosyltran, Phosphoribosyl transferase domain... 219 2e-56 ref|NP_980231.1| pyrimidine operon regulatory protein [Bacillus ... 218 5e-56 ref|NP_389430.1| transcriptional attenuator and uracil phosphori... 216 3e-55 >sp|P41007|PYRR_BACCL PyrR bifunctional protein [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase)] pir||S38892 uracil phosphoribosyltransferase (EC 2.4.2.9) pyrR - Bacillus caldolyticus emb|CAA53696.1| uracil phosphoribosyltransferase [Bacillus caldolyticus] Length = 179 Score = 226 bits (576), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 114/183 (62%), Positives = 142/183 (77%), Gaps = 8/183 (4%) Query: 8 EKNVIMDETAIRRALSRIAHEILEKNKGIENCLLVGIRTRGVYLAQRIAERIKEIEGVDI 67 +K V+MDE AIRRAL+RIAHEI+E+NKGI+ C+LVGI+TRG+YLA+R+AERI++IEG + Sbjct: 2 QKAVVMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGASV 61 Query: 68 PYGELDITHYRDDREGGGDNREAMDRTVVNSNLTLPAGSSGIKDKKVILFDDVLYTGRTI 127 P GELDIT YRDD D+ E + V +N+ P + ++ VIL DDVL+TGRT+ Sbjct: 62 PVGELDITLYRDDLTVKTDDHEPL---VKGTNVPFP-----VTERNVILVDDVLFTGRTV 113 Query: 128 RAAMDALMDCGRPRMIQLAVLADRGHRELPIRPDYIGKNVPTSRHEQIEVALTEFDGKDE 187 RAAMDA+MD GRP IQLAVL DRGHRELPIR D++GKNVPTSR E I V L+E DG D+ Sbjct: 114 RAAMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELSEVDGIDQ 173 Query: 188 VYI 190 V I Sbjct: 174 VSI 176 >ref|NP_243407.1| transcriptional attenuation of the pyrimidine operon/uracil phosphoribosyl transferase [Bacillus halodurans] sp|Q9K9V4|PYRR_BACHD PyrR bifunctional protein [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase)] pir||E83967 pyrimidine operon transcription attenuator pyrR [imported] - Bacillus halodurans (strain C-125) dbj|BAB06260.1| transcriptional attenuation of the pyrimidine operon/uracil phosphoribosyl transferase [Bacillus halodurans] Length = 180 Score = 222 bits (566), Expect = 3e-57, Method: Compositional matrix adjust. Identities = 112/180 (62%), Positives = 134/180 (74%), Gaps = 8/180 (4%) Query: 11 VIMDETAIRRALSRIAHEILEKNKGIENCLLVGIRTRGVYLAQRIAERIKEIEGVDIPYG 70 +I+DE AIRRA +RIAHEI+E+NKG+ +CLLVGI+TRG+YLA R+ ERI+ IEG+ +P G Sbjct: 4 LILDEQAIRRATTRIAHEIIERNKGVSDCLLVGIKTRGIYLANRLQERIETIEGIKLPVG 63 Query: 71 ELDITHYRDDREGGGDNREAMDRTVVNSNLTLPAGSSGIKDKKVILFDDVLYTGRTIRAA 130 E+DIT YRDD E + +P +G KKVIL DDVLYTGRT+RAA Sbjct: 64 EVDITLYRDDLTVKSTTEEP-----ILQGTDVPVDVTG---KKVILIDDVLYTGRTVRAA 115 Query: 131 MDALMDCGRPRMIQLAVLADRGHRELPIRPDYIGKNVPTSRHEQIEVALTEFDGKDEVYI 190 +DALMD GRP IQLAVL DRGHRELPIRPDY+GKNVPTS+ EQI L+E DG DEV I Sbjct: 116 LDALMDLGRPEQIQLAVLIDRGHRELPIRPDYVGKNVPTSKQEQIVAKLSEVDGIDEVTI 175 >ref|NP_657861.1| Pribosyltran, Phosphoribosyl transferase domain [Bacillus anthracis A2012] ref|NP_833611.1| Uracil phosphoribosyltransferase [Bacillus cereus ATCC 14579] ref|NP_846271.1| pyrimidine operon regulatory protein [Bacillus anthracis str. Ames] gb|AAP10812.1| Uracil phosphoribosyltransferase [Bacillus cereus ATCC 14579] gb|AAP27757.1| pyrimidine operon regulatory protein [Bacillus anthracis str. Ames] Length = 180 Score = 219 bits (559), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 112/183 (61%), Positives = 140/183 (76%), Gaps = 8/183 (4%) Query: 8 EKNVIMDETAIRRALSRIAHEILEKNKGIENCLLVGIRTRGVYLAQRIAERIKEIEGVDI 67 EK V++D+ IRRAL+RI+HEI+E+NKG++NC+LVGI+TRG+++AQR+AERI +IEG ++ Sbjct: 3 EKAVVLDDQMIRRALTRISHEIVERNKGVDNCVLVGIKTRGIFIAQRLAERIGQIEGKEM 62 Query: 68 PYGELDITHYRDDREGGGDNREAMDRTVVNSNLTLPAGSSGIKDKKVILFDDVLYTGRTI 127 GELDIT YRDD N+E + V S++ + I KKVIL DDVLYTGRT+ Sbjct: 63 EVGELDITLYRDDLTLQSKNKEPL---VKGSDIPV-----DITKKKVILVDDVLYTGRTV 114 Query: 128 RAAMDALMDCGRPRMIQLAVLADRGHRELPIRPDYIGKNVPTSRHEQIEVALTEFDGKDE 187 RAAMDALMD GRP IQLAVL DRGHRELPIR DY+GKN+PTS E+IEV L E D +D Sbjct: 115 RAAMDALMDLGRPSQIQLAVLVDRGHRELPIRADYVGKNIPTSSEERIEVDLQETDQQDR 174 Query: 188 VYI 190 V I Sbjct: 175 VSI 177 >ref|NP_980231.1| pyrimidine operon regulatory protein [Bacillus cereus ATCC 10987] gb|AAS42839.1| pyrimidine operon regulatory protein [Bacillus cereus ATCC 10987] Length = 180 Score = 218 bits (556), Expect = 5e-56, Method: Compositional matrix adjust. Identities = 112/183 (61%), Positives = 139/183 (75%), Gaps = 8/183 (4%) Query: 8 EKNVIMDETAIRRALSRIAHEILEKNKGIENCLLVGIRTRGVYLAQRIAERIKEIEGVDI 67 EK V++D+ RRAL+RI+HEI+E+NKG++NC+LVGI+TRG+++AQR+AERI +IEG +I Sbjct: 3 EKAVVLDDQMXRRALTRISHEIVERNKGVDNCVLVGIKTRGIFIAQRLAERIGQIEGKEI 62 Query: 68 PYGELDITHYRDDREGGGDNREAMDRTVVNSNLTLPAGSSGIKDKKVILFDDVLYTGRTI 127 GELDIT YRDD N+E + V S++ + I KKVIL DDVLYTGRT+ Sbjct: 63 EVGELDITLYRDDLTLQSKNKEPL---VKGSDIPV-----DITKKKVILVDDVLYTGRTV 114 Query: 128 RAAMDALMDCGRPRMIQLAVLADRGHRELPIRPDYIGKNVPTSRHEQIEVALTEFDGKDE 187 RAAMDALMD GRP IQLAVL DRGHRELPIR DY+GKN+PTS E+IEV L E D +D Sbjct: 115 RAAMDALMDLGRPSQIQLAVLVDRGHRELPIRADYVGKNIPTSSEERIEVDLQETDQQDR 174 Query: 188 VYI 190 V I Sbjct: 175 VSI 177 >ref|NP_389430.1| transcriptional attenuator and uracil phosphoribosyltransferase activity (minor) [Bacillus subtilis] sp|P39765|PYRR_BACSU PyrR bifunctional protein [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase)] pir||B57986 uracil phosphoribosyltransferase (EC 2.4.2.9) pyrR - Bacillus subtilis pdb|1A3C| Pyrr, The Bacillus Subtilis Pyrimidine Biosynthetic Operon Repressor, Dimeric Form pdb|1A4X|A Chain A, Pyrr, The Bacillus Subtilis Pyrimidine Biosynthetic Operon Repressor, Hexameric Form pdb|1A4X|B Chain B, Pyrr, The Bacillus Subtilis Pyrimidine Biosynthetic Operon Repressor, Hexameric Form emb|CAB13421.1| transcriptional attenuator and uracil phosphoribosyltransferase activity (minor) [Bacillus subtilis subsp. subtilis str. 168] gb|AAA21265.2| ORF1A [Bacillus subtilis] Length = 181 Score = 216 bits (550), Expect = 3e-55, Method: Compositional matrix adjust. Identities = 111/188 (59%), Positives = 138/188 (73%), Gaps = 8/188 (4%) Query: 6 VTEKNVIMDETAIRRALSRIAHEILEKNKGIENCLLVGIRTRGVYLAQRIAERIKEIEGV 65 + +K VI+DE AIRRAL+RIAHE++E+NKG+ NC+LVGI+TRG+YLA+R+AERI++IEG Sbjct: 1 MNQKAVILDEQAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGN 60 Query: 66 DIPYGELDITHYRDDREGGGDNREAMDRTVVNSNLTLPAGSSGIKDKKVILFDDVLYTGR 125 + GE+DIT YRDD N E + + +P I D+KVIL DDVLYTGR Sbjct: 61 PVTVGEIDITLYRDDLSKKTSNDEPLVK-----GADIPVD---ITDQKVILVDDVLYTGR 112 Query: 126 TIRAAMDALMDCGRPRMIQLAVLADRGHRELPIRPDYIGKNVPTSRHEQIEVALTEFDGK 185 T+RA MDAL+D GRP IQLAVL DRGHRELPIR DYIGKN+PTS+ E++ V L E D Sbjct: 113 TVRAGMDALVDVGRPSSIQLAVLVDRGHRELPIRADYIGKNIPTSKSEKVMVQLDEVDQN 172 Query: 186 DEVYIISN 193 D V I N Sbjct: 173 DLVAIYEN 180 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.139 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 286,176,525 Number of extensions: 12002338 Number of successful extensions: 28572 Number of sequences better than 1.0e-05: 182 Number of HSP's gapped: 28397 Number of HSP's successfully gapped: 182 Length of query: 197 Length of database: 757,237,578 Length adjustment: 119 Effective length of query: 78 Effective length of database: 434,140,797 Effective search space: 33862982166 Effective search space used: 33862982166 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 122 (51.6 bits)