BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0264.0005.p (133 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||S61274 membrane-associated nuclease nucA - Bacillus subtilis 157 9e-38 ref|NP_390452.1| nuclease [Bacillus subtilis] >gi|1171857|sp|P42... 157 1e-37 sp|P12667|NUCA_BACSU DNA-entry nuclease (Competence-specific nuc... 155 4e-37 ref|NP_388225.1| nuclease [Bacillus subtilis] >gi|710634|dbj|BAA... 154 8e-37 ref|NP_980349.1| competence-specific nuclease [Bacillus cereus A... 150 7e-36 >pir||S61274 membrane-associated nuclease nucA - Bacillus subtilis Length = 147 Score = 157 bits (396), Expect = 9e-38, Method: Compositional matrix adjust. Identities = 67/103 (65%), Positives = 87/103 (84%) Query: 31 LRFPSDRFPETARHIQDAIRSGEASICTIERQEADENRKESLKGVPTKKGYDRDEWPMAM 90 + FPSDR+PETA+HI+DAI G + +CTI+R A+E R++SLKG+P+KKGYDRDEWPMAM Sbjct: 45 MAFPSDRYPETAKHIKDAINEGHSEVCTIDRDGAEERREQSLKGIPSKKGYDRDEWPMAM 104 Query: 91 CEEGGSGADIEYITPSDNRGAGSWVGNQLEGLPDGTQVEFIFK 133 C+EGG GA +EYI+P+DNRGAGSWVG++L PDGT+V F + Sbjct: 105 CKEGGEGASVEYISPADNRGAGSWVGHRLTDYPDGTKVLFTIQ 147 >ref|NP_390452.1| nuclease [Bacillus subtilis] sp|P42983|NUCB_BACSU Sporulation-specific extracellular nuclease precursor pir||S61273 sporulation-specific extracellular nuclease nucB precursor - Bacillus subtilis gb|AAB34262.1| deoxyribonuclease; DNase [Bacillus subtilis] dbj|BAA12437.1| NucB [Bacillus subtilis] emb|CAB14516.1| nuclease [Bacillus subtilis subsp. subtilis str. 168] Length = 136 Score = 157 bits (396), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 70/103 (67%), Positives = 83/103 (80%) Query: 31 LRFPSDRFPETARHIQDAIRSGEASICTIERQEADENRKESLKGVPTKKGYDRDEWPMAM 90 L FP R+PET HI+DAI G ICTI+R AD+ R+ESLKG+PTK GYDRDEWPMA+ Sbjct: 34 LYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPTKPGYDRDEWPMAV 93 Query: 91 CEEGGSGADIEYITPSDNRGAGSWVGNQLEGLPDGTQVEFIFK 133 CEEGG+GAD+ Y+TPSDNRGAGSWVGNQ+ PDGT+V FI + Sbjct: 94 CEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ 136 >sp|P12667|NUCA_BACSU DNA-entry nuclease (Competence-specific nuclease) emb|CAB12137.2| nuclease [Bacillus subtilis subsp. subtilis str. 168] Length = 147 Score = 155 bits (391), Expect = 4e-37, Method: Compositional matrix adjust. Identities = 67/103 (65%), Positives = 86/103 (83%) Query: 31 LRFPSDRFPETARHIQDAIRSGEASICTIERQEADENRKESLKGVPTKKGYDRDEWPMAM 90 + FPSDR+PETA+HI+DAI G + +CTI+R A+E R++SLK VP+KKGYDRDEWPMAM Sbjct: 45 MAFPSDRYPETAKHIKDAINEGHSEVCTIDRDGAEERREQSLKDVPSKKGYDRDEWPMAM 104 Query: 91 CEEGGSGADIEYITPSDNRGAGSWVGNQLEGLPDGTQVEFIFK 133 C+EGG GA +EYI+P+DNRGAGSWVG++L PDGT+V F + Sbjct: 105 CKEGGEGASVEYISPADNRGAGSWVGHRLTDYPDGTKVLFTIQ 147 >ref|NP_388225.1| nuclease [Bacillus subtilis] dbj|BAA06431.1| DNA entry nuclease [Bacillus subtilis] dbj|BAA08977.1| DNA-entry nuclease [Bacillus subtilis] Length = 103 Score = 154 bits (388), Expect = 8e-37, Method: Compositional matrix adjust. Identities = 67/103 (65%), Positives = 86/103 (83%) Query: 31 LRFPSDRFPETARHIQDAIRSGEASICTIERQEADENRKESLKGVPTKKGYDRDEWPMAM 90 + FPSDR+PETA+HI+DAI G + +CTI+R A+E R++SLK VP+KKGYDRDEWPMAM Sbjct: 1 MAFPSDRYPETAKHIKDAINEGHSEVCTIDRDGAEERREQSLKDVPSKKGYDRDEWPMAM 60 Query: 91 CEEGGSGADIEYITPSDNRGAGSWVGNQLEGLPDGTQVEFIFK 133 C+EGG GA +EYI+P+DNRGAGSWVG++L PDGT+V F + Sbjct: 61 CKEGGEGASVEYISPADNRGAGSWVGHRLTDYPDGTKVLFTIQ 103 >ref|NP_980349.1| competence-specific nuclease [Bacillus cereus ATCC 10987] gb|AAS42957.1| competence-specific nuclease [Bacillus cereus ATCC 10987] Length = 144 Score = 150 bits (380), Expect = 7e-36, Method: Compositional matrix adjust. Identities = 67/103 (65%), Positives = 82/103 (79%) Query: 31 LRFPSDRFPETARHIQDAIRSGEASICTIERQEADENRKESLKGVPTKKGYDRDEWPMAM 90 L FP DR+PET +HI DAI+ G + +CTI+R A + RK SL P+KKGYDRDEWPMAM Sbjct: 42 LEFPKDRYPETGKHITDAIKEGHSEVCTIDRGGAADRRKLSLAPYPSKKGYDRDEWPMAM 101 Query: 91 CEEGGSGADIEYITPSDNRGAGSWVGNQLEGLPDGTQVEFIFK 133 C+EGG GA IEYI+P+DNRGAGSWVGN+L+ PDGT+V+F K Sbjct: 102 CKEGGKGAHIEYISPADNRGAGSWVGNKLDKYPDGTRVKFDVK 144 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.314 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 220,864,427 Number of extensions: 9130622 Number of successful extensions: 14667 Number of sequences better than 1.0e-05: 10 Number of HSP's gapped: 14667 Number of HSP's successfully gapped: 10 Length of query: 133 Length of database: 757,237,578 Length adjustment: 95 Effective length of query: 38 Effective length of database: 499,303,173 Effective search space: 18973520574 Effective search space used: 18973520574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)