BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0260.0034.p (98 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_350249.1| MDR-type permease [Clostridium acetobutylicum] ... 98 5e-20 ref|NP_784157.1| transport protein [Lactobacillus plantarum WCFS... 95 4e-19 ref|NP_348080.1| MDR-type permease [Clostridium acetobutylicum] ... 91 6e-18 ref|NP_266536.1| efflux pump antibiotic resistance protein [Lact... 83 2e-15 ref|NP_561017.1| probable multidrug resistance protein [Clostrid... 83 2e-15 >ref|NP_350249.1| MDR-type permease [Clostridium acetobutylicum] pir||B97350 MDR-type permease CAC3668 [imported] - Clostridium acetobutylicum gb|AAK81589.1| MDR-type permease [Clostridium acetobutylicum] Length = 486 Score = 98.2 bits (243), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 45/86 (52%), Positives = 63/86 (73%) Query: 1 MSTVPRTQLGSAGSVNSLVRNVGMVVGITIATSILFNVMSSKAGYRVTDLIPGRPDVFLS 60 MSTVPR +LG AGSVN+L+RN+G VVG + AT +L+N MSSK G+RV D I GR DVF+ Sbjct: 384 MSTVPRNKLGIAGSVNALIRNLGFVVGTSFATLLLYNRMSSKMGHRVVDYIKGRDDVFMY 443 Query: 61 GMHVVFMTSSAICLVSALLTGWRLFS 86 GM V++ + CL+ ++T +R ++ Sbjct: 444 GMKWVYIAAGVFCLMGVIITAFRFYN 469 >ref|NP_784157.1| transport protein [Lactobacillus plantarum WCFS1] emb|CAD62996.1| transport protein [Lactobacillus plantarum WCFS1] Length = 481 Score = 95.1 bits (235), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 41/86 (47%), Positives = 62/86 (72%) Query: 1 MSTVPRTQLGSAGSVNSLVRNVGMVVGITIATSILFNVMSSKAGYRVTDLIPGRPDVFLS 60 MS+V LG AG +N+L R +GM+VGI++AT++L++ MS AGY+VT +P P++F+ Sbjct: 388 MSSVAVKDLGVAGGINALARELGMIVGISVATTVLYSAMSQSAGYKVTSYLPAHPEIFID 447 Query: 61 GMHVVFMTSSAICLVSALLTGWRLFS 86 GMH+ F+ S ICLV+ ++TG RL Sbjct: 448 GMHIAFVVSLGICLVATVITGGRLLK 473 >ref|NP_348080.1| MDR-type permease [Clostridium acetobutylicum] pir||A97079 MDR-type permease [imported] - Clostridium acetobutylicum gb|AAK79420.1| MDR-type permease [Clostridium acetobutylicum] Length = 478 Score = 91.3 bits (225), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 44/86 (51%), Positives = 61/86 (70%) Query: 1 MSTVPRTQLGSAGSVNSLVRNVGMVVGITIATSILFNVMSSKAGYRVTDLIPGRPDVFLS 60 MST + +LG GSVNSLVRN+G +VGIT++T++L++ MS K GYRV D I G+ VF+ Sbjct: 384 MSTCSKNKLGIVGSVNSLVRNLGQIVGITLSTTLLYSFMSYKIGYRVYDYIKGKDFVFVY 443 Query: 61 GMHVVFMTSSAICLVSALLTGWRLFS 86 GM V++ +CL+ ALLT R+F Sbjct: 444 GMRNVYLILVVLCLLGALLTALRIFK 469 >ref|NP_266536.1| efflux pump antibiotic resistance protein [Lactococcus lactis subsp. lactis] pir||D86672 efflux pump antibiotic resistance protein [imported] - Lactococcus lactis subsp. lactis (strain IL1403) gb|AAK04478.1| efflux pump antibiotic resistance protein [Lactococcus lactis subsp. lactis] Length = 467 Score = 83.2 bits (204), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 43/84 (51%), Positives = 57/84 (67%) Query: 1 MSTVPRTQLGSAGSVNSLVRNVGMVVGITIATSILFNVMSSKAGYRVTDLIPGRPDVFLS 60 M TV R LG AGSVNSL RN+ V+G ++AT ILF MS++ GY+VT + +PDVFL Sbjct: 379 METVDRKYLGIAGSVNSLARNMAFVLGTSLATLILFTAMSNQLGYKVTTYLHNQPDVFLH 438 Query: 61 GMHVVFMTSSAICLVSALLTGWRL 84 G HV F S+ + LV+ +L +RL Sbjct: 439 GFHVAFYFSTFLVLVTWVLGLFRL 462 >ref|NP_561017.1| probable multidrug resistance protein [Clostridium perfringens] dbj|BAB79807.1| probable multidrug resistance protein [Clostridium perfringens str. 13] Length = 477 Score = 82.8 bits (203), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 38/83 (45%), Positives = 57/83 (68%) Query: 1 MSTVPRTQLGSAGSVNSLVRNVGMVVGITIATSILFNVMSSKAGYRVTDLIPGRPDVFLS 60 M VP+ +LG AGSVNSLV N+ M G T AT+IL+ MS + GY+VT+ IPG + FL Sbjct: 389 MEKVPKHRLGIAGSVNSLVSNLAMAYGFTFATTILYGRMSYRLGYKVTNYIPGHEEAFLY 448 Query: 61 GMHVVFMTSSAICLVSALLTGWR 83 G+ VF +++ +CL+++++ R Sbjct: 449 GLDCVFFSATIMCLIASVVAFIR 471 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.324 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 104,564,403 Number of extensions: 3016955 Number of successful extensions: 12194 Number of sequences better than 1.0e-05: 10 Number of HSP's gapped: 12199 Number of HSP's successfully gapped: 10 Length of query: 98 Length of database: 757,237,578 Length adjustment: 66 Effective length of query: 32 Effective length of database: 578,041,044 Effective search space: 18497313408 Effective search space used: 18497313408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 120 (50.8 bits)