BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0260.0032.p (144 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_633887.1| transcriptional regulator, MarR family [Methano... 91 8e-18 ref|NP_615153.1| transcriptional regulator, MarR family [Methano... 89 2e-17 ref|ZP_00099023.1| COG1846: Transcriptional regulators [Desulfit... 86 3e-16 ref|ZP_00061101.1| COG1846: Transcriptional regulators [Clostrid... 81 7e-15 ref|NP_616973.1| transcriptional regulator, MarR family [Methano... 75 5e-13 >ref|NP_633887.1| transcriptional regulator, MarR family [Methanosarcina mazei Goe1] gb|AAM31559.1| transcriptional regulator, MarR family [Methanosarcina mazei Goe1] Length = 156 Score = 90.9 bits (224), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 1/107 (0%) Query: 4 SNREPIGKLVSQLHRQNQKYLVKELLPYGIGSGGQHIFLKLIVNHPGITQDQMTNEMKFD 63 ++E IGK +S L+R Q Y+ K++ PYGIGSG Q FL + GI Q+ +++ +K D Sbjct: 16 CDKEFIGKAISYLYRYGQIYIGKKIEPYGIGSG-QFPFLMRLYREDGINQESLSDYLKID 74 Query: 64 KATTARSVKKLEEAGYIERRTDPKDRRSSLLYPTPKAVKFAPVLQSI 110 K TTAR+++KL + GY+ R+ D KDRRS ++ T K K P ++ I Sbjct: 75 KGTTARAIQKLVDEGYVFRQRDEKDRRSYRVFLTEKGKKLEPDMKKI 121 >ref|NP_615153.1| transcriptional regulator, MarR family [Methanosarcina acetivorans str. C2A] gb|AAM03633.1| transcriptional regulator, MarR family [Methanosarcina acetivorans str. C2A] Length = 156 Score = 89.4 bits (220), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 1/107 (0%) Query: 4 SNREPIGKLVSQLHRQNQKYLVKELLPYGIGSGGQHIFLKLIVNHPGITQDQMTNEMKFD 63 +E IGK +S L+R Q Y+ K++ PYGIGSG Q FL + G+ Q+ +++ +K D Sbjct: 16 CGKEFIGKAISYLYRYEQVYIGKKIEPYGIGSG-QFPFLMRLYREDGVNQESLSDYLKID 74 Query: 64 KATTARSVKKLEEAGYIERRTDPKDRRSSLLYPTPKAVKFAPVLQSI 110 K TT R+++KL + GY+ R+ D KDRRS ++ + KA K P ++ I Sbjct: 75 KGTTTRAIQKLADEGYVFRQRDEKDRRSYRIFLSEKAKKLEPDMKKI 121 >ref|ZP_00099023.1| COG1846: Transcriptional regulators [Desulfitobacterium hafniense] Length = 151 Score = 85.9 bits (211), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 40/105 (38%), Positives = 62/105 (59%) Query: 6 REPIGKLVSQLHRQNQKYLVKELLPYGIGSGGQHIFLKLIVNHPGITQDQMTNEMKFDKA 65 R+ + K +S + R +Q Y+ + + Y IG G +L+ N+ GITQ++++ + DKA Sbjct: 8 RKSLIKAISAIDRYSQTYIGRNVKDYNIGQGQWAFLTQLLFNYDGITQEELSELLNIDKA 67 Query: 66 TTARSVKKLEEAGYIERRTDPKDRRSSLLYPTPKAVKFAPVLQSI 110 TAR++KKLEE GY+ R DPKD R ++Y T KA F + Sbjct: 68 NTARALKKLEEEGYVYREEDPKDGRKKIVYVTAKARDFEQEFHEV 112 >ref|ZP_00061101.1| COG1846: Transcriptional regulators [Clostridium thermocellum ATCC 27405] Length = 154 Score = 81.3 bits (199), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 47/137 (34%), Positives = 79/137 (57%), Gaps = 1/137 (0%) Query: 8 PIGKLVSQLHRQNQKYLVKELLPYGIGSGGQHIFLKLIVNHPGITQDQMTNEMKFDKATT 67 IG+L++ L R++Q YL K L Y + + + F+ L N GITQ+++T+ + DKA T Sbjct: 6 SIGRLINLLARKSQMYLGKVLSQYNLTAAEEPFFMAL-QNREGITQEELTSIVCVDKAAT 64 Query: 68 ARSVKKLEEAGYIERRTDPKDRRSSLLYPTPKAVKFAPVLQSIXXXXXXXXXXXXXXXEV 127 AR+V+ LEE GY+ R D KD+R + +YPT KA + +++ ++ Sbjct: 65 ARAVRSLEEKGYLLRIQDEKDKRQNRVYPTEKAKQIGQEVRTELMKFNKLLTRNIKEEDL 124 Query: 128 DQLIALLQKVNKNSAKL 144 D+L +LL ++ +N K+ Sbjct: 125 DRLYSLLLQMEENMNKI 141 >ref|NP_616973.1| transcriptional regulator, MarR family [Methanosarcina acetivorans str. C2A] gb|AAM05453.1| transcriptional regulator, MarR family [Methanosarcina acetivorans str. C2A] Length = 153 Score = 75.1 bits (183), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 38/99 (38%), Positives = 61/99 (61%), Gaps = 2/99 (2%) Query: 2 LNSNREPIGKLVSQLHRQNQKYLVKELLPYGIGSGGQHIFLKLIVNHPGITQDQMTNEMK 61 + RE G ++ ++R + Y+ KEL PYGIGSG Q FL ++ GI+Q+ + +K Sbjct: 1 MEDPREICGP-IAHIYRSHLAYMAKELEPYGIGSG-QFDFLMVLYRRDGISQETLARTLK 58 Query: 62 FDKATTARSVKKLEEAGYIERRTDPKDRRSSLLYPTPKA 100 KAT+ R+++ LE+ GY+ R+ D +DRR+ +Y T K Sbjct: 59 VSKATSTRAIQSLEKEGYVYRQVDEEDRRAYKVYLTEKG 97 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.316 0.133 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 177,328,479 Number of extensions: 5915803 Number of successful extensions: 16117 Number of sequences better than 1.0e-05: 37 Number of HSP's gapped: 16137 Number of HSP's successfully gapped: 37 Length of query: 144 Length of database: 757,237,578 Length adjustment: 104 Effective length of query: 40 Effective length of database: 474,867,282 Effective search space: 18994691280 Effective search space used: 18994691280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)