BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0260.0006.p (112 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_654158.1| SBP_bac_5, Bacterial extracellular solute-bindi... 91 1e-17 ref|NP_976576.1| oligopeptide ABC transporter, oligopeptide-bind... 87 1e-16 ref|NP_976575.1| oligopeptide ABC transporter, substrate-binding... 87 2e-16 ref|NP_830109.1| Oligopeptide-binding protein oppA [Bacillus cer... 82 4e-15 ref|NP_349776.1| Oligopeptide ABC transporter, periplasmic bindi... 77 9e-14 >ref|NP_654158.1| SBP_bac_5, Bacterial extracellular solute-binding proteins, family 5 [Bacillus anthracis A2012] ref|NP_842787.1| oligopeptide ABC transporter, oligopeptide-binding protein, putative [Bacillus anthracis str. Ames] gb|AAP24273.1| oligopeptide ABC transporter, oligopeptide-binding protein, putative [Bacillus anthracis str. Ames] Length = 555 Score = 90.5 bits (223), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 44/110 (40%), Positives = 71/110 (64%), Gaps = 3/110 (2%) Query: 1 VSKVEGGDYDLVSFSTSMLTDPADGFMQFFDGEI---TDYDNPKFLELYNKALATTDIEQ 57 +SKV GDYDL + ST ++DP++ ++ T Y+NPK EL K + TTDIE+ Sbjct: 440 LSKVGKGDYDLAAVSTPGISDPSEVVSEYLSTNPKSDTGYNNPKVDELIVKGIGTTDIEK 499 Query: 58 RKAVYKELYQLFNDELPILFTSYKKTVYAYNGRIQNLTVSPFIGLAGSLP 107 RKA+YKELY+ +D+ P++ +Y+K +YA+N RI+ + + ++ +LP Sbjct: 500 RKAIYKELYKELSDDPPVILLNYRKLLYAHNARIKGIDPEKYDSISSNLP 549 >ref|NP_976576.1| oligopeptide ABC transporter, oligopeptide-binding protein, putative [Bacillus cereus ATCC 10987] gb|AAS39184.1| oligopeptide ABC transporter, oligopeptide-binding protein, putative [Bacillus cereus ATCC 10987] Length = 575 Score = 87.4 bits (215), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 43/110 (39%), Positives = 69/110 (62%), Gaps = 3/110 (2%) Query: 1 VSKVEGGDYDLVSFSTSMLTDPADGFMQFFDGEI---TDYDNPKFLELYNKALATTDIEQ 57 +SKV GDYDL + ST ++DP++ + T Y NPK +L K + TTDIE+ Sbjct: 460 LSKVGKGDYDLAAVSTPGISDPSEVVSDYLSTNPKSDTGYSNPKVDDLIVKGIGTTDIEK 519 Query: 58 RKAVYKELYQLFNDELPILFTSYKKTVYAYNGRIQNLTVSPFIGLAGSLP 107 RKA+YKELY+ +D+ P++ +Y+K +YA+N RI+ + + ++ +LP Sbjct: 520 RKAIYKELYKELSDDPPVILLNYRKLLYAHNARIKGIDPEKYDSISSNLP 569 >ref|NP_976575.1| oligopeptide ABC transporter, substrate-binding protein, putative [Bacillus cereus ATCC 10987] gb|AAS39183.1| oligopeptide ABC transporter, substrate-binding protein, putative [Bacillus cereus ATCC 10987] Length = 567 Score = 86.7 bits (213), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 47/115 (40%), Positives = 69/115 (60%), Gaps = 3/115 (2%) Query: 1 VSKVEGGDYDLVSFSTSMLTDPADGFMQFFDGEITDYD---NPKFLELYNKALATTDIEQ 57 +SKV GDYDL ST M+ DP+ +F +YD NPK EL +AL T DIE+ Sbjct: 452 ISKVIKGDYDLAMVSTPMIDDPSGTIEEFVSTSKRNYDGYHNPKVDELAKQALETLDIEK 511 Query: 58 RKAVYKELYQLFNDELPILFTSYKKTVYAYNGRIQNLTVSPFIGLAGSLPEWTLK 112 RK +YK+LYQ +++ P++F + K V A++ RIQ L + G+ SLP+ ++ Sbjct: 512 RKEIYKKLYQELSEDPPVIFLNNSKVVSAHHARIQGLQEDNYNGILLSLPKLKIE 566 >ref|NP_830109.1| Oligopeptide-binding protein oppA [Bacillus cereus ATCC 14579] gb|AAP07310.1| Oligopeptide-binding protein oppA [Bacillus cereus ATCC 14579] Length = 575 Score = 82.0 bits (201), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 41/110 (37%), Positives = 67/110 (60%), Gaps = 3/110 (2%) Query: 1 VSKVEGGDYDLVSFSTSMLTDPADGFMQFFD--GEIT-DYDNPKFLELYNKALATTDIEQ 57 +SKV GDYDL S ST + +DP++ ++ E + Y N K EL K + T DIE+ Sbjct: 460 LSKVNKGDYDLASVSTPITSDPSETAGEYLSTANETSLGYKNAKVDELIQKGIETVDIEK 519 Query: 58 RKAVYKELYQLFNDELPILFTSYKKTVYAYNGRIQNLTVSPFIGLAGSLP 107 RK +YKELY+ +D+ P++ +Y++T+ YNG I+ + + ++ +LP Sbjct: 520 RKPIYKELYKELSDDPPVILLNYRRTITGYNGNIKGIDPEKYNSISANLP 569 >ref|NP_349776.1| Oligopeptide ABC transporter, periplasmic binding component [Clostridium acetobutylicum] pir||A97291 oligopeptide ABC transporter, periplasmic binding component CAC3179 [imported] - Clostridium acetobutylicum gb|AAK81116.1| Oligopeptide ABC transporter, periplasmic binding component [Clostridium acetobutylicum] Length = 567 Score = 77.4 bits (189), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 38/109 (34%), Positives = 66/109 (60%), Gaps = 4/109 (3%) Query: 1 VSKVEGGDYDLVSFSTSMLTDPADGFMQFFDGE----ITDYDNPKFLELYNKALATTDIE 56 V K+ GDYDL + TS L DP D +F + ++ Y NPK EL ++ + T +++ Sbjct: 450 VEKLNKGDYDLAAVRTSGLVDPNDSVEEFSSKKTSENVSGYFNPKVDELISEGVNTLNVK 509 Query: 57 QRKAVYKELYQLFNDELPILFTSYKKTVYAYNGRIQNLTVSPFIGLAGS 105 +RKA+YK+LY+ +D+ P++ Y+K + A+N RI+ + F G++ + Sbjct: 510 KRKAIYKKLYKELSDDPPVILIDYRKGLKAWNSRIKGMENDNFAGVSST 558 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 176,992,388 Number of extensions: 6692340 Number of successful extensions: 18297 Number of sequences better than 1.0e-05: 6 Number of HSP's gapped: 18299 Number of HSP's successfully gapped: 6 Length of query: 112 Length of database: 757,237,578 Length adjustment: 78 Effective length of query: 34 Effective length of database: 545,459,856 Effective search space: 18545635104 Effective search space used: 18545635104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)