BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0260.0003.p (96 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_373045.1| conserved hypothetical protein [Staphylococcus ... 83 2e-15 ref|NP_647258.1| conserved hypothetical protein [Staphylococcus ... 82 5e-15 ref|ZP_00182220.1| hypothetical protein Exigu248201 [Exiguobacte... 78 6e-14 ref|NP_290760.1| orf, hypothetical protein [Escherichia coli O15... 77 1e-13 ref|NP_418551.1| hypothetical protein b4127 [Escherichia coli K1... 77 1e-13 >ref|NP_373045.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_375633.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] pir||B90056 conserved hypothetical protein SA2309 [imported] - Staphylococcus aureus (strain N315) dbj|BAB43612.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB58683.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] Length = 94 Score = 82.8 bits (203), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 47/94 (50%), Positives = 62/94 (65%), Gaps = 5/94 (5%) Query: 1 VKNMESIEQGEGRFYIAGDGKD-LAEITYR-TDETTGNWVIDHTFVSEDLRGQGAGEKLV 58 + N+E I+QGE +FYI D + LAEITYR D N IDHT VS++L GQG G+KLV Sbjct: 1 MSNLE-IKQGENKFYIGDDENNALAEITYRFVDNNEIN--IDHTGVSDELGGQGVGKKLV 57 Query: 59 RAVVDKARAEQVKIVPQCPYAAHQFKKHEEYGDV 92 +AVV+ AR +KI+ C +A H +K + Y DV Sbjct: 58 KAVVEHARENHLKIIASCSFAKHMLEKEDSYQDV 91 >ref|NP_647258.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] dbj|BAB96306.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 94 Score = 81.6 bits (200), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 47/94 (50%), Positives = 61/94 (64%), Gaps = 5/94 (5%) Query: 1 VKNMESIEQGEGRFYIAGD-GKDLAEITYR-TDETTGNWVIDHTFVSEDLRGQGAGEKLV 58 + N+E I+QGE +FYI D LAEITYR D N IDHT VS++L GQG G+KLV Sbjct: 1 MSNLE-IKQGENKFYIGDDENHALAEITYRFVDNNEIN--IDHTGVSDELGGQGVGKKLV 57 Query: 59 RAVVDKARAEQVKIVPQCPYAAHQFKKHEEYGDV 92 +AVV+ AR +KI+ C +A H +K + Y DV Sbjct: 58 KAVVEHARENHLKIIASCSFAKHMLEKEDSYQDV 91 >ref|ZP_00182220.1| hypothetical protein Exigu248201 [Exiguobacterium sp. 255-15] Length = 89 Score = 77.8 bits (190), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 35/74 (47%), Positives = 53/74 (71%), Gaps = 1/74 (1%) Query: 19 DGKDLAEITYRTDETTGNWVIDHTFVSEDLRGQGAGEKLVRAVVDKARAEQVKIVPQCPY 78 +G+ + EITY +D G W+IDHT+V + R Q GE+LV+A+V+ AR EQVK++P CP+ Sbjct: 15 EGQAVGEITY-SDTKGGKWIIDHTYVDPNHRNQQIGEQLVKAIVEWAREEQVKLLPLCPF 73 Query: 79 AAHQFKKHEEYGDV 92 A +F++ +Y DV Sbjct: 74 AKKEFEQTPDYADV 87 >ref|NP_290760.1| orf, hypothetical protein [Escherichia coli O157:H7 EDL933] ref|NP_313136.1| hypothetical protein ECs5109 [Escherichia coli O157:H7] ref|NP_756982.1| Hypothetical protein yjdJ [Escherichia coli CFT073] pir||E91267 hypothetical protein ECs5109 [imported] - Escherichia coli (strain O157:H7, substrain RIMD 0509952) pir||B86108 hypothetical protein yjdJ [imported] - Escherichia coli (strain O157:H7, substrain EDL933) gb|AAG59326.1| orf, hypothetical protein [Escherichia coli O157:H7 EDL933] dbj|BAB38532.1| hypothetical protein [Escherichia coli O157:H7] gb|AAN83556.1| Hypothetical protein yjdJ [Escherichia coli CFT073] Length = 90 Score = 77.4 bits (189), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 42/90 (46%), Positives = 58/90 (64%), Gaps = 4/90 (4%) Query: 7 IEQGEGRFYIAGD-GKDLAEITY-RTDETTGNWVIDHTFVSEDLRGQGAGEKLVRAVVDK 64 I +G +FYI + GK +AEI + T E +I+HT V E L+GQG G++LV VV+K Sbjct: 3 IREGHNKFYINDEQGKQIAEIVFVPTGENLA--IIEHTDVDESLKGQGIGKQLVAKVVEK 60 Query: 65 ARAEQVKIVPQCPYAAHQFKKHEEYGDVLS 94 R E+ KI+P CP+A H+F K EY D+ S Sbjct: 61 MRREKRKIIPLCPFAKHEFDKTREYDDIRS 90 >ref|NP_418551.1| hypothetical protein b4127 [Escherichia coli K12] sp|P39274|YJDJ_ECOLI Hypothetical protein yjdJ pir||S56356 hypothetical 10.5K protein (dcub-lysu intergenic region) - Escherichia coli (strain K-12) gb|AAA97027.1| ORF_o90a [Escherichia coli] gb|AAC77088.1| orf, hypothetical protein [Escherichia coli K12] Length = 90 Score = 76.6 bits (187), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 42/90 (46%), Positives = 57/90 (63%), Gaps = 4/90 (4%) Query: 7 IEQGEGRFYIAG-DGKDLAEITY-RTDETTGNWVIDHTFVSEDLRGQGAGEKLVRAVVDK 64 I +G +FYI GK +AEI + T E +I+HT V E L+GQG G++LV VV+K Sbjct: 3 IREGHNKFYINDKQGKQIAEIVFVPTGENLA--IIEHTDVDESLKGQGIGKQLVAKVVEK 60 Query: 65 ARAEQVKIVPQCPYAAHQFKKHEEYGDVLS 94 R E+ KI+P CP+A H+F K EY D+ S Sbjct: 61 MRREKRKIIPLCPFAKHEFDKTREYDDIRS 90 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 145,241,401 Number of extensions: 5343515 Number of successful extensions: 9378 Number of sequences better than 1.0e-05: 30 Number of HSP's gapped: 9377 Number of HSP's successfully gapped: 30 Length of query: 96 Length of database: 757,237,578 Length adjustment: 64 Effective length of query: 32 Effective length of database: 583,471,242 Effective search space: 18671079744 Effective search space used: 18671079744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 120 (50.8 bits)