BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0256.0057.p (44 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_692718.1| GTP binding protein [Oceanobacillus iheyensis H... 70 1e-11 ref|NP_390165.1| similar to hypothetical proteins [Bacillus subt... 69 4e-11 ref|NP_465461.1| similar to unknown protein [Listeria monocytoge... 68 7e-11 ref|NP_471385.1| similar to unknown protein [Listeria innocua] >... 67 2e-10 ref|NP_371999.1| hypothetical protein [Staphylococcus aureus sub... 66 3e-10 >ref|NP_692718.1| GTP binding protein [Oceanobacillus iheyensis HTE831] sp|Q8EQA8|ENGA_OCEIH GTP-binding protein engA dbj|BAC13753.1| GTP binding protein [Oceanobacillus iheyensis HTE831] Length = 436 Score = 70.5 bits (171), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 31/40 (77%), Positives = 34/40 (85%) Query: 1 VFVNDPSLMHFSYERYLENKIRAAFNFEGTPIRLFTRRKS 40 VFVNDP LMHFSYER+LENKIR AF F GTPI+LF RR+ Sbjct: 397 VFVNDPELMHFSYERFLENKIRDAFGFVGTPIKLFARRRQ 436 >ref|NP_390165.1| similar to hypothetical proteins [Bacillus subtilis] sp|P50743|ENGA_BACSU GTP-binding protein engA pir||A69936 probable GTP binding protein yphC - Bacillus subtilis gb|AAC83966.1| similar to Escherichia coli GTP-binding protein Era; putative [Bacillus subtilis] emb|CAB14200.1| yphC [Bacillus subtilis subsp. subtilis str. 168] Length = 436 Score = 68.6 bits (166), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 29/39 (74%), Positives = 34/39 (87%) Query: 1 VFVNDPSLMHFSYERYLENKIRAAFNFEGTPIRLFTRRK 39 VFVNDP LMHFSYER+LEN+IR AF FEGTPI++F R + Sbjct: 397 VFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARAR 435 >ref|NP_465461.1| similar to unknown protein [Listeria monocytogenes EGD-e] sp|Q8Y5W8|ENGA_LISMO GTP-binding protein engA pir||AI1316 hypothetical protein lmo1937 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAD00015.1| lmo1937 [Listeria monocytogenes] Length = 436 Score = 67.8 bits (164), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 29/39 (74%), Positives = 34/39 (87%) Query: 1 VFVNDPSLMHFSYERYLENKIRAAFNFEGTPIRLFTRRK 39 VFVNDP LMHFSYER+LEN+IR AF FEGTPIR+ R++ Sbjct: 397 VFVNDPELMHFSYERFLENRIREAFPFEGTPIRVIARKR 435 >ref|NP_471385.1| similar to unknown protein [Listeria innocua] sp|Q92A71|ENGA_LISIN GTP-binding protein engA pir||AI1688 hypothetical protein homolog lin2051 [imported] - Listeria innocua (strain Clip11262) emb|CAC97281.1| lin2051 [Listeria innocua] Length = 436 Score = 66.6 bits (161), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 28/39 (71%), Positives = 34/39 (87%) Query: 1 VFVNDPSLMHFSYERYLENKIRAAFNFEGTPIRLFTRRK 39 VFVNDP LMHFSYER+LEN+IR AF F+GTPIR+ R++ Sbjct: 397 VFVNDPELMHFSYERFLENRIREAFPFDGTPIRVIARKR 435 >ref|NP_371999.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374589.1| hypothetical protein, similar to GTP binding protein [Staphylococcus aureus subsp. aureus N315] ref|NP_646181.1| ORFID:MW1364~hypothetical protein, similar to GTP binding protein [Staphylococcus aureus subsp. aureus MW2] sp|Q99U15|ENGA_STAAM GTP-binding protein engA pir||C89926 hypothetical protein SA1307 [imported] - Staphylococcus aureus (strain N315) dbj|BAB42568.1| SA1307 [Staphylococcus aureus subsp. aureus N315] dbj|BAB57637.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB95229.1| MW1364 [Staphylococcus aureus subsp. aureus MW2] Length = 436 Score = 65.9 bits (159), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 28/39 (71%), Positives = 33/39 (84%) Query: 1 VFVNDPSLMHFSYERYLENKIRAAFNFEGTPIRLFTRRK 39 VFVND LMHFSY+RYLEN+IRAAF FEGTPI + R++ Sbjct: 397 VFVNDVELMHFSYKRYLENQIRAAFGFEGTPIHIIARKR 435 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.323 0.139 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 64,358,520 Number of extensions: 1604230 Number of successful extensions: 3042 Number of sequences better than 1.0e-05: 39 Number of HSP's gapped: 3043 Number of HSP's successfully gapped: 39 Length of query: 44 Length of database: 757,237,578 Length adjustment: 17 Effective length of query: 27 Effective length of database: 711,080,895 Effective search space: 19199184165 Effective search space used: 19199184165 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)