BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0256.0046.p (82 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9X6J6|MTRB_BACST Transcription attenuation protein mtrB (Try... 108 3e-23 ref|ZP_00060118.1| hypothetical protein [Clostridium thermocellu... 108 3e-23 ref|ZP_00180130.1| hypothetical protein Mther193701 [Moorella th... 108 5e-23 ref|NP_242513.1| tryptophan operon RNA-binding attenuation prote... 104 7e-22 sp|P48064|MTRB_BACPU Transcription attenuation protein mtrB (Try... 103 1e-21 >sp|Q9X6J6|MTRB_BACST Transcription attenuation protein mtrB (Tryptophan RNA-binding attenuator protein) (Trp RNA-binding attenuation protein) (TRAP) pdb|1QAW|A Chain A, Regulatory Features Of The Trp Operon And The Crystal Structure Of The Trp Rna-Binding Attenuation Protein From Bacillus Stearothermophilus. pdb|1QAW|B Chain B, Regulatory Features Of The Trp Operon And The Crystal Structure Of The Trp Rna-Binding Attenuation Protein From Bacillus Stearothermophilus. pdb|1QAW|C Chain C, Regulatory Features Of The Trp Operon And The Crystal Structure Of The Trp Rna-Binding Attenuation Protein From Bacillus Stearothermophilus. pdb|1QAW|D Chain D, Regulatory Features Of The Trp Operon And The Crystal Structure Of The Trp Rna-Binding Attenuation Protein From Bacillus Stearothermophilus. pdb|1QAW|E Chain E, Regulatory Features Of The Trp Operon And The Crystal Structure Of The Trp Rna-Binding Attenuation Protein From Bacillus Stearothermophilus. pdb|1QAW|F Chain F, Regulatory Features Of The Trp Operon And The Crystal Structure Of The Trp Rna-Binding Attenuation Protein From Bacillus Stearothermophilus. pdb|1QAW|G Chain G, Regulatory Features Of The Trp Operon And The Crystal Structure Of The Trp Rna-Binding Attenuation Protein From Bacillus Stearothermophilus. pdb|1QAW|H Chain H, Regulatory Features Of The Trp Operon And The Crystal Structure Of The Trp Rna-Binding Attenuation Protein From Bacillus Stearothermophilus. pdb|1QAW|I Chain I, Regulatory Features Of The Trp Operon And The Crystal Structure Of The Trp Rna-Binding Attenuation Protein From Bacillus Stearothermophilus. pdb|1QAW|J Chain J, Regulatory Features Of The Trp Operon And The Crystal Structure Of The Trp Rna-Binding Attenuation Protein From Bacillus Stearothermophilus. pdb|1QAW|K Chain K, Regulatory Features Of The Trp Operon And The Crystal Structure Of The Trp Rna-Binding Attenuation Protein From Bacillus Stearothermophilus. pdb|1C9S|A Chain A, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|B Chain B, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|C Chain C, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|D Chain D, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|E Chain E, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|F Chain F, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|G Chain G, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|H Chain H, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|I Chain I, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|J Chain J, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|K Chain K, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|L Chain L, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|M Chain M, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|N Chain N, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|O Chain O, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|P Chain P, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|Q Chain Q, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|R Chain R, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|S Chain S, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|T Chain T, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|U Chain U, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1C9S|V Chain V, Crystal Structure Of A Complex Of Trp Rna-Binding Attenuation Protein With A 53-Base Single Stranded Rna Containing Eleven Gag Triplets Separated By Au Dinucleotide pdb|1GTF|A Chain A, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|B Chain B, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|C Chain C, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|D Chain D, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|E Chain E, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|F Chain F, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|G Chain G, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|H Chain H, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|I Chain I, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|J Chain J, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|K Chain K, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|L Chain L, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|M Chain M, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|N Chain N, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|O Chain O, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|P Chain P, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|Q Chain Q, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|R Chain R, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|S Chain S, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|T Chain T, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|U Chain U, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTF|V Chain V, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A 53-Nucleotide Rna Molecule Containing Gaguu Repeats pdb|1GTN|A Chain A, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|B Chain B, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|C Chain C, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|D Chain D, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|E Chain E, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|F Chain F, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|G Chain G, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|H Chain H, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|I Chain I, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|J Chain J, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|K Chain K, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|L Chain L, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|M Chain M, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|N Chain N, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|O Chain O, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|P Chain P, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|Q Chain Q, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|R Chain R, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|S Chain S, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|T Chain T, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|U Chain U, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1GTN|V Chain V, Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To An Rna Molecule Containing 11 Gagcc Repeats pdb|1UTD|A Chain A, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|B Chain B, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|C Chain C, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|D Chain D, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|E Chain E, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|F Chain F, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|G Chain G, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|H Chain H, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|I Chain I, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|J Chain J, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|K Chain K, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|L Chain L, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|M Chain M, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|N Chain N, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|O Chain O, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|P Chain P, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|Q Chain Q, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|R Chain R, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|S Chain S, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|T Chain T, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|U Chain U, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTD|V Chain V, The Structure Of The Trp Ran-Binding Attenuation Protein (Trap) Bound To A 63-Nucleotide Rna Molecule Containing Gaguuu Repeats pdb|1UTF|A Chain A, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|B Chain B, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|C Chain C, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|D Chain D, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|E Chain E, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|F Chain F, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|G Chain G, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|H Chain H, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|I Chain I, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|J Chain J, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|K Chain K, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|L Chain L, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|M Chain M, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|N Chain N, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|O Chain O, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|P Chain P, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|Q Chain Q, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|R Chain R, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|S Chain S, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|T Chain T, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|U Chain U, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTF|V Chain V, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part I) pdb|1UTV|A Chain A, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|B Chain B, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|C Chain C, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|D Chain D, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|E Chain E, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|F Chain F, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|G Chain G, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|H Chain H, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|I Chain I, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|J Chain J, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|K Chain K, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|L Chain L, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|M Chain M, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|N Chain N, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|O Chain O, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|P Chain P, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|Q Chain Q, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|R Chain R, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|S Chain S, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|T Chain T, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|U Chain U, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) pdb|1UTV|V Chain V, The Structure Of The Trp Rna-Binding Attenuation Protein (Trap) Bound To A Rna Molecule Containing Uagau Repeats (Part Ii) gb|AAD33793.1| trp RNA-binding attenuation protein [Geobacillus stearothermophilus] Length = 74 Score = 108 bits (271), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 50/67 (74%), Positives = 61/67 (91%) Query: 15 SDYIVIKAKENGVQVIGLTRGLDTRFHHTEKLDKGEVLIAQFTDHTSAMKIRGRAEIWSK 74 SD++VIKA E+GV VIGLTRG DTRFHH+EKLDKGEVLIAQFT+HTSA+K+RG+A I ++ Sbjct: 5 SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTR 64 Query: 75 HGQLESE 81 HG +ESE Sbjct: 65 HGVIESE 71 >ref|ZP_00060118.1| hypothetical protein [Clostridium thermocellum ATCC 27405] Length = 83 Score = 108 bits (271), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 51/65 (78%), Positives = 60/65 (92%) Query: 16 DYIVIKAKENGVQVIGLTRGLDTRFHHTEKLDKGEVLIAQFTDHTSAMKIRGRAEIWSKH 75 DYIVIKA+ENGV +IGLTRG DT+FHHTEKLDKGEVLIAQFTD+TSA+KIRG+A I S+H Sbjct: 17 DYIVIKAEENGVNIIGLTRGKDTKFHHTEKLDKGEVLIAQFTDNTSAIKIRGKARILSRH 76 Query: 76 GQLES 80 G++ S Sbjct: 77 GEVYS 81 >ref|ZP_00180130.1| hypothetical protein Mther193701 [Moorella thermoacetica ATCC 39073] Length = 77 Score = 108 bits (269), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 48/67 (71%), Positives = 60/67 (89%) Query: 14 GSDYIVIKAKENGVQVIGLTRGLDTRFHHTEKLDKGEVLIAQFTDHTSAMKIRGRAEIWS 73 +D+IVIKA ENGV +IGLTRG DT+FHH+EKLDKGE++IAQFT+HTSAMKIRGRA + + Sbjct: 9 AADFIVIKALENGVTIIGLTRGRDTKFHHSEKLDKGEIMIAQFTEHTSAMKIRGRALVMT 68 Query: 74 KHGQLES 80 K+G LE+ Sbjct: 69 KYGSLEA 75 >ref|NP_242513.1| tryptophan operon RNA-binding attenuation protein (TRAP) [Bacillus halodurans] pir||G83855 tryptophan operon RNA-binding attenuation protein (TRAP) mtrB [imported] - Bacillus halodurans (strain C-125) dbj|BAB05366.1| tryptophan operon RNA-binding attenuation protein (TRAP) [Bacillus halodurans] Length = 76 Score = 104 bits (259), Expect = 7e-22, Method: Compositional matrix adjust. Identities = 47/67 (70%), Positives = 59/67 (88%) Query: 15 SDYIVIKAKENGVQVIGLTRGLDTRFHHTEKLDKGEVLIAQFTDHTSAMKIRGRAEIWSK 74 S++ VIKAKENGV V G+TRG DTRFHH+EKLDKGEV+IAQFT+HTSA+KIRG+A I + Sbjct: 7 SNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTS 66 Query: 75 HGQLESE 81 +G L++E Sbjct: 67 YGTLDTE 73 >sp|P48064|MTRB_BACPU Transcription attenuation protein mtrB (Tryptophan RNA-binding attenuator protein) (Trp RNA-binding attenuation protein) (TRAP) pir||I39905 trp RNA-binding protein - Bacillus pumilus gb|AAA67544.1| trp RNA-binding protein Length = 76 Score = 103 bits (258), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 47/69 (68%), Positives = 60/69 (86%) Query: 14 GSDYIVIKAKENGVQVIGLTRGLDTRFHHTEKLDKGEVLIAQFTDHTSAMKIRGRAEIWS 73 SD++VIKA +NGV VIGLTRG DTRFHH+EKLDKGEV+IAQFT+HTSA+K+RG A I + Sbjct: 6 ASDFVVIKAIDNGVNVIGLTRGSDTRFHHSEKLDKGEVIIAQFTEHTSAIKVRGDAVIQT 65 Query: 74 KHGQLESES 82 G+++SE+ Sbjct: 66 SFGEIQSEA 74 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.313 0.130 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 122,371,750 Number of extensions: 4014216 Number of successful extensions: 6203 Number of sequences better than 1.0e-05: 7 Number of HSP's gapped: 6203 Number of HSP's successfully gapped: 7 Length of query: 82 Length of database: 757,237,578 Length adjustment: 52 Effective length of query: 30 Effective length of database: 616,052,430 Effective search space: 18481572900 Effective search space used: 18481572900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)