BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0254.0033.p (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAI15991.1| unknown [environmental sequence] 80 9e-14 ref|NP_800429.1| transcriptional regulator [Vibrio parahaemolyti... 80 1e-13 ref|NP_349816.1| Response regulator (CheY-like receiver domain a... 79 1e-13 ref|NP_762283.1| Response regulator [Vibrio vulnificus CMCP6] >g... 79 2e-13 ref|NP_232956.1| transcriptional regulator [Vibrio cholerae O1 b... 79 2e-13 >gb|EAI15991.1| unknown [environmental sequence] Length = 227 Score = 80.1 bits (196), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 45/92 (48%), Positives = 58/92 (63%), Gaps = 2/92 (2%) Query: 1 MHLELNNSEYKVMADGITITLLPKEFALLQFLYRNVGRTFSREQLLDHVWPLEYPVE-RT 59 + +EL++ ++V +G+ + L P E+ LL F GR +REQLLDHVW + VE RT Sbjct: 136 LDIELDSETHRVFRNGVEVKLGPTEYRLLSFFMERPGRVRTREQLLDHVWGRDIYVESRT 195 Query: 60 VDDHIYRLRKKLHVLSGLD-IKTVRGFGYSLA 90 VD HI RLRK L GLD I+TVR GYSL Sbjct: 196 VDVHIGRLRKALIKNGGLDPIRTVRSVGYSLG 227 >ref|NP_800429.1| transcriptional regulator [Vibrio parahaemolyticus RIMD 2210633] dbj|BAC62262.1| transcriptional regulator [Vibrio parahaemolyticus] Length = 220 Score = 79.7 bits (195), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 42/88 (47%), Positives = 59/88 (67%), Gaps = 4/88 (4%) Query: 3 LELNNSEYKVMADGITITLLPKEFALLQFLYRNVGRTFSREQLLDHVWPLE-YPVERTVD 61 LE++ + +V+ G ITL EF LL FL N+GR F+R++LLDHVW +P RTVD Sbjct: 134 LEIDRATREVIFKGDLITLTRTEFDLLLFLASNLGRVFTRDELLDHVWGYNHFPTTRTVD 193 Query: 62 DHIYRLRKKLHVLSGLDIKTVRGFGYSL 89 H+ +LR+K L GL+I+T+RG GY + Sbjct: 194 THVLQLRQK---LPGLEIETLRGVGYKM 218 >ref|NP_349816.1| Response regulator (CheY-like receiver domain and HTH-type DNA-binding domain) [Clostridium acetobutylicum] pir||A97296 response regulator (CheY-like receiver domain and HTH-type DNA-binding domain) [imported] - Clostridium acetobutylicum gb|AAK81156.1| Response regulator (CheY-like receiver domain and HTH-type DNA-binding domain) [Clostridium acetobutylicum] Length = 228 Score = 79.3 bits (194), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 42/90 (46%), Positives = 57/90 (63%), Gaps = 1/90 (1%) Query: 3 LELNNSEYKVMADGITITLLPKEFALLQFLYRNVGRTFSREQLLDHVWPLEYPVE-RTVD 61 L+++ Y V+ + I + PKEF LL +L N + F+REQLL VW +YP + RTVD Sbjct: 138 LKIDMGSYTVIYNEKDIKMPPKEFELLYYLANNKNKVFTREQLLCEVWGYDYPGDSRTVD 197 Query: 62 DHIYRLRKKLHVLSGLDIKTVRGFGYSLAV 91 H+ RLR+KLH +G DI+TV G GY V Sbjct: 198 VHVKRLREKLHEGNGWDIQTVWGVGYKFEV 227 >ref|NP_762283.1| Response regulator [Vibrio vulnificus CMCP6] gb|AAO07273.1| Response regulator [Vibrio vulnificus CMCP6] Length = 220 Score = 79.3 bits (194), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 4/89 (4%) Query: 2 HLELNNSEYKVMADGITITLLPKEFALLQFLYRNVGRTFSREQLLDHVWPLE-YPVERTV 60 +L ++ S +V G ITL EF LL FL N+GR F+R++LLDHVW +P RTV Sbjct: 133 NLVIDKSTREVFFKGEQITLTRTEFDLLLFLASNLGRVFTRDELLDHVWGYNHFPTTRTV 192 Query: 61 DDHIYRLRKKLHVLSGLDIKTVRGFGYSL 89 D H+ +LR+K L+GL+I+T+RG GY + Sbjct: 193 DTHVLQLRQK---LAGLEIETLRGVGYKM 218 >ref|NP_232956.1| transcriptional regulator [Vibrio cholerae O1 biovar eltor str. N16961] pir||G82444 transcription regulator VCA0566 [imported] - Vibrio cholerae (strain N16961 serogroup O1) gb|AAF96468.1| transcriptional regulator [Vibrio cholerae O1 biovar eltor str. N16961] Length = 245 Score = 79.3 bits (194), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 4/89 (4%) Query: 2 HLELNNSEYKVMADGITITLLPKEFALLQFLYRNVGRTFSREQLLDHVWPLE-YPVERTV 60 +L ++ + +V +G +ITL EF LL FL N+GR F+R++LLDHVW +P RTV Sbjct: 158 NLTIDKATREVFFNGESITLTRTEFDLLLFLASNLGRVFTRDELLDHVWGYNHFPTTRTV 217 Query: 61 DDHIYRLRKKLHVLSGLDIKTVRGFGYSL 89 D H+ +LR+K L GL+I+T+RG GY + Sbjct: 218 DTHVLQLRQK---LPGLEIETLRGVGYKM 243 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.323 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 578,179,322 Number of extensions: 24380132 Number of successful extensions: 56128 Number of sequences better than 1.0e-05: 650 Number of HSP's gapped: 56387 Number of HSP's successfully gapped: 650 Length of query: 384 Length of database: 757,237,578 Length adjustment: 127 Effective length of query: 257 Effective length of database: 412,420,005 Effective search space: 105991941285 Effective search space used: 105991941285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 127 (53.5 bits)