BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0250.0011.p (99 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_346865.1| Response regulator (CheY-like receiver domain a... 86 2e-16 ref|NP_347011.1| Response regulator (CheY-like domain and HTH do... 86 3e-16 gb|AAD10258.1| putative response regulator [Lactobacillus sakei] 85 5e-16 ref|NP_391352.1| similar to two-component response regulator [Yv... 83 2e-15 ref|NP_241621.1| two-component response regulator [Bacillus halo... 83 2e-15 >ref|NP_346865.1| Response regulator (CheY-like receiver domain and HTH DNA-binding domain) [Clostridium acetobutylicum] pir||B96927 response regulator (CheY-like receiver domain and HTH DNA-binding domain) [imported] - Clostridium acetobutylicum gb|AAK78205.1| Response regulator (CheY-like receiver domain and HTH DNA-binding domain) [Clostridium acetobutylicum] Length = 223 Score = 85.9 bits (211), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 37/89 (41%), Positives = 62/89 (69%), Gaps = 1/89 (1%) Query: 1 LILLDINLGQTSGFELCKRLRKTMKAPILFISARSSDDDILIALNIGGDDYTHKPYTLSV 60 L+L+DINL GF C ++R K P++F+S+RSS+ D+++A+N+GGDDY KP+++ + Sbjct: 48 LVLMDINLPVCDGFYWCSKIRNISKVPVIFLSSRSSNMDVVMAVNMGGDDYITKPFSIEI 107 Query: 61 LLAKVRAVLKRYGGQYTVEAPEILEFGKV 89 L+AK+ A+L+R Y+ + +EF V Sbjct: 108 LMAKINAILRR-TYSYSETEMDTIEFKDV 135 >ref|NP_347011.1| Response regulator (CheY-like domain and HTH domain) [Clostridium acetobutylicum] pir||D96945 response regulator (CheY-like domain and HTH domain) [imported] - Clostridium acetobutylicum gb|AAK78351.1| Response regulator (CheY-like domain and HTH domain) [Clostridium acetobutylicum] Length = 228 Score = 85.5 bits (210), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 39/84 (46%), Positives = 59/84 (70%) Query: 1 LILLDINLGQTSGFELCKRLRKTMKAPILFISARSSDDDILIALNIGGDDYTHKPYTLSV 60 L+LLD+NL GF LC+ R+ KAPI+F+SARSS+ + + L +G DDY KP++ + Sbjct: 48 LVLLDVNLPYYDGFNLCRIFRRKSKAPIIFMSARSSEIEQIRGLEMGADDYITKPFSFEL 107 Query: 61 LLAKVRAVLKRYGGQYTVEAPEIL 84 LLAKV+A ++R G+Y+ + E+L Sbjct: 108 LLAKVQASIRRTYGEYSEDNSEVL 131 >gb|AAD10258.1| putative response regulator [Lactobacillus sakei] Length = 224 Score = 85.1 bits (209), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 34/71 (47%), Positives = 58/71 (81%) Query: 1 LILLDINLGQTSGFELCKRLRKTMKAPILFISARSSDDDILIALNIGGDDYTHKPYTLSV 60 L+LLDINL GF C+++R+ K PI+FIS+RS++ D+++++N+GGDD+ +KP+++ V Sbjct: 48 LVLLDINLPVYDGFYWCRKIREVSKVPIIFISSRSTNMDMVMSMNMGGDDFVNKPFSMEV 107 Query: 61 LLAKVRAVLKR 71 L+AK+ A+L+R Sbjct: 108 LIAKINALLRR 118 >ref|NP_391352.1| similar to two-component response regulator [YvcQ] [Bacillus subtilis] pir||D70032 two-component response regulator [YvcQ] homolog yvcP - Bacillus subtilis emb|CAB08062.1| hypothetical protein [Bacillus subtilis] emb|CAB15477.1| yvcP [Bacillus subtilis subsp. subtilis str. 168] Length = 237 Score = 82.8 bits (203), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 40/90 (44%), Positives = 62/90 (68%), Gaps = 3/90 (3%) Query: 1 LILLDINLGQTSGFELCKRLRKTMKAPILFISARSSDDDILIALNIGGDDYTHKPYTLSV 60 L+LLDINL GF C+++R API+FISAR+ + + ++A+ GGDDY KP+ L V Sbjct: 48 LVLLDINLPFFDGFYWCRQIRTISNAPIIFISARTDELNQVMAIENGGDDYITKPFHLEV 107 Query: 61 LLAKVRAVLKRYGGQYTVEAPE---ILEFG 87 ++AK+++VL+R G+Y+ P+ I+E G Sbjct: 108 VMAKIKSVLRRTYGEYSPSLPQESRIVELG 137 >ref|NP_241621.1| two-component response regulator [Bacillus halodurans] pir||C83744 two-component response regulator BH0755 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04474.1| two-component response regulator [Bacillus halodurans] Length = 232 Score = 82.8 bits (203), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 40/78 (51%), Positives = 54/78 (69%) Query: 1 LILLDINLGQTSGFELCKRLRKTMKAPILFISARSSDDDILIALNIGGDDYTHKPYTLSV 60 L+LLDINL GF C++LR+ PI+F+SAR+S+ D + A+ GGDDY KP+ L V Sbjct: 48 LVLLDINLPAFDGFYWCRQLRRLSNLPIIFLSARASEMDQVYAIENGGDDYITKPFHLEV 107 Query: 61 LLAKVRAVLKRYGGQYTV 78 LLAKV+ VL+R G Y + Sbjct: 108 LLAKVKGVLRRSYGDYAI 125 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.324 0.142 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 137,260,308 Number of extensions: 4595091 Number of successful extensions: 18341 Number of sequences better than 1.0e-05: 2071 Number of HSP's gapped: 18401 Number of HSP's successfully gapped: 2071 Length of query: 99 Length of database: 757,237,578 Length adjustment: 66 Effective length of query: 33 Effective length of database: 578,041,044 Effective search space: 19075354452 Effective search space used: 19075354452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 120 (50.8 bits)