BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0250.0003.p (265 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_971100.1| membrane protein, putative [Treponema denticola... 107 2e-22 ref|ZP_00170912.1| hypothetical protein Raeut219801 [Ralstonia e... 84 2e-15 ref|NP_293927.1| conserved hypothetical protein [Deinococcus rad... 57 6e-07 ref|ZP_00060662.1| COG4587: ABC-type uncharacterized transport s... 53 7e-06 >ref|NP_971100.1| membrane protein, putative [Treponema denticola ATCC 35405] gb|AAS10981.1| membrane protein, putative [Treponema denticola ATCC 35405] Length = 266 Score = 107 bits (268), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 61/227 (26%), Positives = 109/227 (48%), Gaps = 6/227 (2%) Query: 8 KACISLFRIRMAEGLQYRASAISGVFVSVFWGLLECVLFTVFYTYSDNGAWNNNGLALPQ 67 K +S F+IR LQYRA+A++G+ WG L +LF FY S N + Sbjct: 2 KKYLSFFKIRFIANLQYRAAALAGISTQFAWGTLNIILFKAFYESSP----ENFPMGFSA 57 Query: 68 TISYVWLAQGLFVLQTM-SIDSEIMGKINNGDVGVELCRPLNLYTHWFVKSSAGKLGTSW 126 +SY+W+ Q M + +S+I I +G + ++ +P+N+Y WF +S A +L Sbjct: 58 FVSYIWMQQAFLAFFAMWTFESDITDSIVSGSIAYQMSKPINIYNLWFTRSVALRLARGL 117 Query: 127 LRSLATILTGLLMPAGYALGAPASALGFACFLLSVVMAFVLCSSFAMFVTAIRLNITWGD 186 LR ++ ++P Y L P L F F+ S+++ ++F + + Sbjct: 118 LRCFPVLIIASILPQPYRLIMP-DLLTFFIFITSMILGLCTAAAFTCLIYVLCFFTVSPK 176 Query: 187 GPTYMLLLFSGILSGTYLPLRLWPDFMQTFLYLQPFGGFADIPVQLY 233 G + S +L G +P+ +P+ ++ L PF G +IP++++ Sbjct: 177 GLQIVFFSASEMLMGQIIPIPFFPETIKKILEFSPFTGIQNIPLRIF 223 >ref|ZP_00170912.1| hypothetical protein Raeut219801 [Ralstonia eutropha JMP134] Length = 279 Score = 84.3 bits (207), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 80/256 (31%), Positives = 116/256 (45%), Gaps = 10/256 (3%) Query: 1 MNFRSTFKACISLFRIRMAEGLQYRASAISGVFVSVFWGLLECVLFTVFYTYSDNGAWNN 60 M R + ++ FR R + LQYR +A +G F +WG ++ ++ FY + Sbjct: 2 MAPRELARPYLAAFRSRFLQMLQYRLAAYAGFFTQCWWGGIKIMVLAAFYGSAST---RE 58 Query: 61 NGLALPQTISYVWLAQGLFVLQTMSIDSEIMGKINNGDVGVELCRPLNLYTHWFVKSSAG 120 L L Q I+Y WLAQGL L S D E+ + G V + RP+N Y WF + +AG Sbjct: 59 APLTLGQVITYTWLAQGLLALLPWSGDPEVAQAVRTGAVAYDRLRPVNAYALWFAR-TAG 117 Query: 121 KLGTSWLRSLATILT--GLLMP----AGYALGAPASALGFACFLLSVVMAFVLCSSFAMF 174 L + +LT G+L+P +A PA F+ S ++A +L +S M Sbjct: 118 WTAARVLPRVTMMLTFAGVLLPIVGLGDWAWEPPAGLAAGMGFIASALLALLLSTSLVML 177 Query: 175 VTAIRLNITWGDGPTYMLLLFSGILSGTYLPLRLWPDFMQTFLYLQPFGGFADIPVQLYV 234 + G + + +LSG LPL L PD Q L QP G DIP ++Y Sbjct: 178 LNIAAAAALNERGINTLAVPVVIVLSGNLLPLALLPDAWQAALLAQPLAGVMDIPARIYF 237 Query: 235 GSLMPSAXXXXLQLAC 250 G L + L L C Sbjct: 238 GQLGGAQMFTALGLQC 253 >ref|NP_293927.1| conserved hypothetical protein [Deinococcus radiodurans] pir||E75548 conserved hypothetical protein - Deinococcus radiodurans (strain R1) gb|AAF09788.1| conserved hypothetical protein [Deinococcus radiodurans] Length = 275 Score = 56.6 bits (135), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 60/230 (26%), Positives = 97/230 (42%), Gaps = 20/230 (8%) Query: 11 ISLFRIRMAEGLQYRASAISGVFVSVFWGLLECVLFTVFYTYSDNGAWNNNGLALPQTIS 70 ++L R+ Y +A+ G+ ++F+GLL + + +G GL ++ Sbjct: 20 LALARLGFRRQFAYLQAALWGLVTNLFFGLLRISILLALF----DGRPQVAGLTGGDAVT 75 Query: 71 YVWLAQGLFVLQTMSIDSEIMGKINNGDVGVELCRPLNLYTHWFVKSSAGKLGTSWLRSL 130 YV L Q ++ SE M I+ G+V +L RPL+L W + + G LR L Sbjct: 76 YVALTQTFIASFSLFGWSEFMRTIHRGEVATDLLRPLDLLASWAAQDAGRAAGQFVLRGL 135 Query: 131 A-----TILTGLLMPAGYALGAPASALGFACFLLSVVMAFVLCSSFAMFVTAIRLNITWG 185 +L G MPA P LLSVV A+ ++ V Sbjct: 136 PMLVLFALLWGARMPA-----LPPET------LLSVVPAWACGFAYRFLVNCAAFWSPDA 184 Query: 186 DGPTYMLLLFSGILSGTYLPLRLWPDFMQTFLYLQPFGGFADIPVQLYVG 235 G + G+ G +PLRL+PD+++ L PF + V+L++G Sbjct: 185 VGIGRFAWVLLGLGCGFLMPLRLFPDWLRAALAWTPFPSMLNTTVELWLG 234 >ref|ZP_00060662.1| COG4587: ABC-type uncharacterized transport system, permease component [Clostridium thermocellum ATCC 27405] Length = 284 Score = 52.8 bits (125), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 52/219 (23%), Positives = 98/219 (44%), Gaps = 17/219 (7%) Query: 24 YRASAISGVFVSVFWGLLECVLFTVFYTYSDNGAWNNNGLALPQTISYVWLAQGLFVLQT 83 YR+ +FV L++ ++ Y+ + +GL L Q ++Y +A + L Sbjct: 33 YRSHLAVSIFVGPVTFLVQIFIWNAVYSAENRLDSTLSGLTLNQMLAYFGIATTINYLIY 92 Query: 84 MSIDSEIMGKINNGDVGVELCRPLNLYTHWFVKSSAGKLGTSWLRSLATILTGL------ 137 S D ++ I G+ + RP++ F + +L W+ + L L Sbjct: 93 DSADWDLQTLIRTGNFITFMLRPVSHCYFAFCEKIGHRLLALWVEFIPVYLLFLFVFKIN 152 Query: 138 LMPAGYALGAPASALGFACFLLSVVMAFVLCSSFAMFVTAIRLNITWGDGPTYMLLLFSG 197 L+PA + +LGF V+ F++ ++ + +T L T +G L+ Sbjct: 153 LIPANLVWTLISISLGF-------VLMFLI--NYCIGITGFWLTKT--EGLRRAFLVLRD 201 Query: 198 ILSGTYLPLRLWPDFMQTFLYLQPFGGFADIPVQLYVGS 236 + +G +PL L+PDF+Q L+ PF A +P ++++GS Sbjct: 202 LCAGALVPLTLFPDFIQKILFFLPFQFVAYVPTRVFIGS 240 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.327 0.140 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 386,994,775 Number of extensions: 15792968 Number of successful extensions: 46279 Number of sequences better than 1.0e-05: 10 Number of HSP's gapped: 46274 Number of HSP's successfully gapped: 10 Length of query: 265 Length of database: 757,237,578 Length adjustment: 123 Effective length of query: 142 Effective length of database: 423,280,401 Effective search space: 60105816942 Effective search space used: 60105816942 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 125 (52.8 bits)