BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0249.0026.p (164 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00097130.1| COG1695: Predicted transcriptional regulators... 100 1e-20 dbj|BAB72058.1| AclS [Streptomyces galilaeus] 60 2e-08 ref|NP_347468.1| Fusion: transcriptional regulator and conserved... 59 3e-08 ref|NP_980346.1| conserved hypothetical protein [Bacillus cereus... 55 5e-07 ref|NP_658039.1| hypothetical protein predicted by GeneMark [Bac... 55 7e-07 >ref|ZP_00097130.1| COG1695: Predicted transcriptional regulators [Desulfitobacterium hafniense] Length = 171 Score = 100 bits (248), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 52/143 (36%), Positives = 89/143 (62%), Gaps = 2/143 (1%) Query: 1 MSGYEIQQKMISAQTDKWAYVQPASIYHALRKLDKDELVRLEKLEQTGNRSKAIYSITSK 60 MSGY+IQQ + ++W V SIYHAL+K++++ V + +E+TG+R KA+YSIT Sbjct: 7 MSGYDIQQALQLTDAERWGGVLIGSIYHALKKMEQEGYVAVTSIERTGHRQKAVYSITEA 66 Query: 61 GKHEFNSMLISSFKKASVVFPSALYTVLTFMDEAPKEEIIGALEVQQQAIQTIYDEMKAG 120 GK ++ + K +SV++PS LY+ L+F ++ K+E AL+ Q+ A++ Y+ +K G Sbjct: 67 GKIYLQELIKDALKMSSVLYPSTLYSGLSFYEKLAKDECRKALQQQRSALEEEYNAVKQG 126 Query: 121 --QKEKEKYSEVSKNVLLIFENM 141 K+ ++ V+L+ +NM Sbjct: 127 LAAKDAAMNHKIPPMVMLVMDNM 149 >dbj|BAB72058.1| AclS [Streptomyces galilaeus] Length = 213 Score = 60.1 bits (144), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 2/73 (2%) Query: 3 GYEIQQKMISAQTDKWAYVQPASIYHALRKLDKDELVRLEKLEQTGNRSKAIYSITSKGK 62 GY ++ +++S D WA V+P SIYHALR+L KD L LE E + YS+T +G Sbjct: 22 GYRVRAELLSWGIDDWANVKPGSIYHALRQLAKDGL--LEASEIMDWPGRVDYSVTPEGD 79 Query: 63 HEFNSMLISSFKK 75 EF +L+ + ++ Sbjct: 80 EEFFRLLVDALER 92 >ref|NP_347468.1| Fusion: transcriptional regulator and conserved domain [Clostridium acetobutylicum] pir||E97002 fusion: transcription regulator and conserved domain CAC0832 [imported] - Clostridium acetobutylicum gb|AAK78808.1| Fusion: transcriptional regulator and conserved domain [Clostridium acetobutylicum] Length = 240 Score = 59.3 bits (142), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 44/141 (31%), Positives = 74/141 (52%), Gaps = 5/141 (3%) Query: 3 GYEIQQKMISAQTDKWAYVQPASIYHALRKLDKDELVRLEKLEQTGNRSKAIYSITSKGK 62 GY+IQ+ + D+WA V+ SIY+AL KL+KD + + E+TG R + IY+I+ KG Sbjct: 17 GYDIQRFIEIDGMDQWAKVKSGSIYYALNKLEKDGFIFTLREERTGARIRKIYAISDKGV 76 Query: 63 HEFNSMLISSFKKASVVFPSALYTVLTFMDEAPKEEIIGALEVQQQAIQTIYDEMKAGQK 122 E +L K + + + + ++EII ++ +Q IQ++ K + Sbjct: 77 EELRRVLKEELLKPIDNVEADKFMIYLMFNRLERDEII---DLTRQHIQSLEQRKKWWED 133 Query: 123 -EKEKYSEVSKNV-LLIFENM 141 K K SE + V +L F+N+ Sbjct: 134 GRKIKVSEATLKVEILHFDNV 154 >ref|NP_980346.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS42954.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 185 Score = 55.5 bits (132), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 64/120 (53%), Gaps = 9/120 (7%) Query: 4 YEIQQKMISAQTDKWAYVQPASIYHALRKLDKDELVRLEKLEQTGNR-SKAIYSITSKGK 62 YE+Q M Q D + S+Y+A +L+K +R+ + + NR K I+ IT++GK Sbjct: 19 YEVQHIMKERQMDCYIKYAKGSLYYAFEQLEKQGAIRVTTIVRDTNRPDKTIFHITNEGK 78 Query: 63 HEFNSMLISSFKKASVVFPSALYTVLTFMDEAPKEEIIGALEVQQ-------QAIQTIYD 115 F+++L+ F+ + ++ +Y+ L+F +E+I LE ++ +QTIYD Sbjct: 79 RLFHTLLLKQFEAKNQIY-KPIYSALSFAHFGDDQELIPILEKKKNDTVQYLHNMQTIYD 137 >ref|NP_658039.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_846452.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP27938.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 185 Score = 54.7 bits (130), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 34/120 (28%), Positives = 63/120 (52%), Gaps = 9/120 (7%) Query: 4 YEIQQKMISAQTDKWAYVQPASIYHALRKLDKDELVRLEKLEQTGNR-SKAIYSITSKGK 62 YE+Q M Q D + S+Y+A +L+K +R+ + + NR K I+ IT +GK Sbjct: 19 YEVQHIMKERQMDCYIKYAKGSLYYAFEQLEKQRAIRVTTIVRDTNRPDKTIFHITEEGK 78 Query: 63 HEFNSMLISSFKKASVVFPSALYTVLTFMDEAPKEEIIGALEVQQ-------QAIQTIYD 115 F+++L+ F+ + ++ +Y+ L+F +E++ LE ++ +QTIYD Sbjct: 79 RLFHTLLLKQFEAKNQIY-KPIYSALSFAHFGNDQELVPILEKKKNDTIQYLHNMQTIYD 137 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.313 0.128 0.342 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 194,490,605 Number of extensions: 6939886 Number of successful extensions: 19704 Number of sequences better than 1.0e-05: 7 Number of HSP's gapped: 19715 Number of HSP's successfully gapped: 7 Length of query: 164 Length of database: 757,237,578 Length adjustment: 116 Effective length of query: 48 Effective length of database: 442,286,094 Effective search space: 21229732512 Effective search space used: 21229732512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 121 (51.2 bits)