BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0247.0037.p (138 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_471504.1| similar to large conductance mechanosensitive c... 124 5e-28 ref|NP_834375.1| Large-conductance mechanosensitive channel [Bac... 124 9e-28 ref|NP_981101.1| large conductance mechanosensitive channel prot... 124 1e-27 gb|EAI41775.1| unknown [environmental sequence] 120 1e-26 ref|NP_691942.1| large conductance mechanosensitive channel [Oce... 119 3e-26 >ref|NP_471504.1| similar to large conductance mechanosensitive channel protein [Listeria innocua] sp|Q929V3|MSCL_LISIN Large-conductance mechanosensitive channel pir||AH1703 large conductance mechanosensitive channel protein homolog lin2170 [imported] - Listeria innocua (strain Clip11262) emb|CAC97400.1| lin2170 [Listeria innocua] Length = 128 Score = 124 bits (312), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 63/94 (67%), Positives = 77/94 (81%) Query: 5 EMWEEFKKFALKGNVLDLAVAVVIGAAFGKIVSSLVTDIIMPLVGILTGGIDLKGLSFAY 64 +M EF+ FALKGNVLDLAVAVVIGAAFGKIVSSLV +IIMP VG+L GG+D LSF Sbjct: 3 KMLVEFRDFALKGNVLDLAVAVVIGAAFGKIVSSLVNNIIMPFVGVLLGGLDFSDLSFKV 62 Query: 65 GDAVVKYGVFLQSVVDFFIIAFSIFMVVKLVNRF 98 G +V++YG F+QS+VDF IIAF+IF+ VK++ F Sbjct: 63 GKSVIQYGAFIQSIVDFVIIAFAIFIFVKVLTSF 96 >ref|NP_834375.1| Large-conductance mechanosensitive channel [Bacillus cereus ATCC 14579] gb|AAP11576.1| Large-conductance mechanosensitive channel [Bacillus cereus ATCC 14579] Length = 132 Score = 124 bits (310), Expect = 9e-28, Method: Compositional matrix adjust. Identities = 61/92 (66%), Positives = 72/92 (78%) Query: 6 MWEEFKKFALKGNVLDLAVAVVIGAAFGKIVSSLVTDIIMPLVGILTGGIDLKGLSFAYG 65 MW EFKKFA KGNV+DLAV VVIGAAFGKIVSSLV DII PL+G++ GG+D L F YG Sbjct: 1 MWNEFKKFAFKGNVVDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVLGGVDFTSLHFGYG 60 Query: 66 DAVVKYGVFLQSVVDFFIIAFSIFMVVKLVNR 97 + V YG F+Q++ DF IIA SIFM VK+ N+ Sbjct: 61 KSAVMYGNFIQTIFDFLIIAASIFMFVKVFNK 92 >ref|NP_981101.1| large conductance mechanosensitive channel protein [Bacillus cereus ATCC 10987] gb|AAS43709.1| large conductance mechanosensitive channel protein [Bacillus cereus ATCC 10987] Length = 132 Score = 124 bits (310), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 61/92 (66%), Positives = 72/92 (78%) Query: 6 MWEEFKKFALKGNVLDLAVAVVIGAAFGKIVSSLVTDIIMPLVGILTGGIDLKGLSFAYG 65 MW EFKKFA KGNV+DLAV VVIGAAFGKIVSSLV DII PL+G++ GG+D L F YG Sbjct: 1 MWNEFKKFAFKGNVVDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVLGGVDFTSLHFGYG 60 Query: 66 DAVVKYGVFLQSVVDFFIIAFSIFMVVKLVNR 97 + V YG F+Q++ DF IIA SIFM VK+ N+ Sbjct: 61 KSAVMYGNFIQTIFDFLIIAASIFMFVKVFNK 92 >gb|EAI41775.1| unknown [environmental sequence] Length = 135 Score = 120 bits (301), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 7/100 (7%) Query: 8 EEFKKFALKGNVLDLAVAVVIGAAFGKIVSSLVTDIIMPLVGILTGGIDLKGLSF----A 63 +EF++FA++GNV+DLAV V+IGAAFGKIVSSLV DIIMP +G+L GGID K L+F A Sbjct: 4 KEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQLAFTLREA 63 Query: 64 YGD---AVVKYGVFLQSVVDFFIIAFSIFMVVKLVNRFKR 100 GD V+ YGVF+Q+V DF I+AF+IFM +KL+NR R Sbjct: 64 QGDVPAVVMHYGVFIQNVFDFVIVAFAIFMAIKLINRLNR 103 >ref|NP_691942.1| large conductance mechanosensitive channel [Oceanobacillus iheyensis HTE831] dbj|BAC12977.1| large conductance mechanosensitive channel [Oceanobacillus iheyensis HTE831] Length = 130 Score = 119 bits (297), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 63/132 (47%), Positives = 83/132 (62%), Gaps = 2/132 (1%) Query: 6 MWEEFKKFALKGNVLDLAVAVVIGAAFGKIVSSLVTDIIMPLVGILTGGIDLKGLSFAYG 65 MW+EFK+FA KGN++DLAVAVVIG AFG IV+S V +II PL+G++ GG+D L G Sbjct: 1 MWKEFKEFAFKGNIIDLAVAVVIGGAFGAIVTSFVENIITPLMGVIVGGVDFTTLKVTVG 60 Query: 66 DAVVKYGVFLQSVVDFFIIAFSIFMVVKLVNRFKRXXXXXXXXXXXXXXXXXXXXXXXIR 125 +A + YG F+QS VDF IIAFSIF+ +K + +FKR IR Sbjct: 61 EAEILYGNFIQSFVDFIIIAFSIFLAIKFLVKFKRQKEEEEVEAVVEELSKQEELLTEIR 120 Query: 126 DLLRTDKQGQKD 137 DLL+ +Q K+ Sbjct: 121 DLLK--EQSNKN 130 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.328 0.146 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 156,268,942 Number of extensions: 5181750 Number of successful extensions: 21037 Number of sequences better than 1.0e-05: 140 Number of HSP's gapped: 20926 Number of HSP's successfully gapped: 140 Length of query: 138 Length of database: 757,237,578 Length adjustment: 99 Effective length of query: 39 Effective length of database: 488,442,777 Effective search space: 19049268303 Effective search space used: 19049268303 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 120 (50.8 bits)