BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0247.0020.p (174 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P35160|RESA_BACSU Thiol-disulfide oxidoreductase resA 140 1e-32 ref|NP_390196.1| essential protein similar to cytochrome c bioge... 125 3e-28 ref|NP_977919.1| resA protein [Bacillus cereus ATCC 10987] >gi|4... 124 9e-28 ref|NP_242443.1| cytochrome c biogenesis (thioredoxin) [Bacillus... 120 2e-26 ref|NP_831252.1| ResA protein [Bacillus cereus ATCC 14579] >gi|3... 118 7e-26 >sp|P35160|RESA_BACSU Thiol-disulfide oxidoreductase resA Length = 179 Score = 140 bits (353), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 67/154 (43%), Positives = 92/154 (59%), Gaps = 1/154 (0%) Query: 21 GYAISSSVFGGDGKPREGGKAPSFXXXXXXXXXXXXXXYKGKSVVLNFWGSWCAPCVKEM 80 GY I ++VF G EG AP+F KGK V LNFWG+WC PC KE Sbjct: 22 GYTIYNAVFAGKESISEGSDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKEF 81 Query: 81 PALQAQWEKWKEQGVVVVGINVGEDQMTVENFVKQVDINFPVVMDTGRDAVRSYGVSPLP 140 P + Q++ +K QGV +V +NVGE ++ V NF+K +NFPVV+DT R + +Y VSPLP Sbjct: 82 PYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLP 141 Query: 141 TTFFINTKGRVDSIHIGQLDLSTLDDQIRKLVEP 174 TTF IN +G+V + G + S + D + L++P Sbjct: 142 TTFLINPEGKVVKVVTGTMTESMIHDYMN-LIKP 174 >ref|NP_390196.1| essential protein similar to cytochrome c biogenesis protein [Bacillus subtilis] pir||S45556 thioredoxin related protein resA - Bacillus subtilis gb|AAA67494.1| ORFX14 emb|CAB14247.1| essential protein similar to cytochrome c biogenesis protein [Bacillus subtilis subsp. subtilis str. 168] Length = 181 Score = 125 bits (315), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 59/134 (44%), Positives = 82/134 (61%), Gaps = 1/134 (0%) Query: 41 APSFXXXXXXXXXXXXXXYKGKSVVLNFWGSWCAPCVKEMPALQAQWEKWKEQGVVVVGI 100 AP+F KGK V LNFWG+WC PC KE P + Q++ +K QGV +V + Sbjct: 44 APNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAV 103 Query: 101 NVGEDQMTVENFVKQVDINFPVVMDTGRDAVRSYGVSPLPTTFFINTKGRVDSIHIGQLD 160 NVGE ++ V NF+K +NFPVV+DT R + +Y VSPLPTTF IN +G+V + G + Sbjct: 104 NVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMT 163 Query: 161 LSTLDDQIRKLVEP 174 S + D + L++P Sbjct: 164 ESMIHDYM-NLIKP 176 >ref|NP_977919.1| resA protein [Bacillus cereus ATCC 10987] gb|AAS40527.1| resA protein [Bacillus cereus ATCC 10987] Length = 173 Score = 124 bits (311), Expect = 9e-28, Method: Compositional matrix adjust. Identities = 56/151 (37%), Positives = 88/151 (58%) Query: 21 GYAISSSVFGGDGKPREGGKAPSFXXXXXXXXXXXXXXYKGKSVVLNFWGSWCAPCVKEM 80 G+ + F + K G +AP+F +KGK V LNFWG+WC PC KEM Sbjct: 21 GFTLYQGYFSKEEKMEIGKEAPNFVVTDLEGKKIELKDFKGKGVFLNFWGTWCKPCEKEM 80 Query: 81 PALQAQWEKWKEQGVVVVGINVGEDQMTVENFVKQVDINFPVVMDTGRDAVRSYGVSPLP 140 P + + K+KE+GV ++ ++ E + V+NFVKQ D+ FPV +D G + +++YGV PLP Sbjct: 81 PYMNELYPKYKEKGVEIIALDADETDIAVKNFVKQYDLKFPVAIDKGGEIIKTYGVIPLP 140 Query: 141 TTFFINTKGRVDSIHIGQLDLSTLDDQIRKL 171 T+F I+ G+V G+ L++ ++K+ Sbjct: 141 TSFLIDKDGKVIQEIKGEQTKEQLEEYLKKI 171 >ref|NP_242443.1| cytochrome c biogenesis (thioredoxin) [Bacillus halodurans] sp|Q9KCJ4|RESA_BACHD Thiol-disulfide oxidoreductase resA pir||A83847 cytochrome c biogenesis (thioredoxin) resA [imported] - Bacillus halodurans (strain C-125) dbj|BAB05296.1| cytochrome c biogenesis (thioredoxin) [Bacillus halodurans] Length = 176 Score = 120 bits (300), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 52/154 (33%), Positives = 88/154 (57%), Gaps = 1/154 (0%) Query: 21 GYAISSSVFGGDGKPREGGKAPSFXXXXXXXXXXXXXXYKGKSVVLNFWGSWCAPCVKEM 80 GY S+ F R G +A +F +GK V LNFWG++C PC +EM Sbjct: 22 GYTFYSNFFADRSLARAGEQAVNFVLEDLEGESIELRELEGKGVFLNFWGTYCPPCEREM 81 Query: 81 PALQAQWEKWKEQGVVVVGINVGEDQMTVENFVKQVDINFPVVMDTGRDAVRSYGVSPLP 140 P ++ + ++KEQGV ++ +N E ++TV+ FV + ++FP+V+D G + + +YG+ PLP Sbjct: 82 PHMEKLYGEYKEQGVEIIAVNANEPELTVQRFVDRYGLSFPIVIDKGLNVIDAYGIRPLP 141 Query: 141 TTFFINTKGRVDSIHIGQLDLSTLDDQIRKLVEP 174 TT IN G + +H G + + ++ +L++P Sbjct: 142 TTILINEHGEIVKVHTGGMT-EQMVEEFMELIKP 174 >ref|NP_831252.1| ResA protein [Bacillus cereus ATCC 14579] sp|Q81FU5|RESA_BACCR Thiol-disulfide oxidoreductase resA gb|AAP08453.1| ResA protein [Bacillus cereus ATCC 14579] Length = 173 Score = 118 bits (295), Expect = 7e-26, Method: Compositional matrix adjust. Identities = 55/151 (36%), Positives = 84/151 (55%) Query: 21 GYAISSSVFGGDGKPREGGKAPSFXXXXXXXXXXXXXXYKGKSVVLNFWGSWCAPCVKEM 80 G+ + F K + G +AP+F KGK V LNFWG+WC PC KEM Sbjct: 21 GFTLYQGFFANKEKMQIGKEAPNFIVTDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEM 80 Query: 81 PALQAQWEKWKEQGVVVVGINVGEDQMTVENFVKQVDINFPVVMDTGRDAVRSYGVSPLP 140 P + + K+KE+GV ++ ++ E + V+NFV Q + FPV +D G+ + +YGV PLP Sbjct: 81 PYMNELYPKYKEKGVEIIALDADETDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLP 140 Query: 141 TTFFINTKGRVDSIHIGQLDLSTLDDQIRKL 171 T+F I+ G+V IG+ L+ ++K+ Sbjct: 141 TSFLIDKDGKVVEQIIGEQTKEQLEGYLKKI 171 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.137 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 235,594,290 Number of extensions: 8911412 Number of successful extensions: 20883 Number of sequences better than 1.0e-05: 549 Number of HSP's gapped: 20969 Number of HSP's successfully gapped: 549 Length of query: 174 Length of database: 757,237,578 Length adjustment: 117 Effective length of query: 57 Effective length of database: 439,570,995 Effective search space: 25055546715 Effective search space used: 25055546715 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 121 (51.2 bits)