BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0236.0015.p (93 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_694070.1| hypothetical protein OB3148 [Oceanobacillus ihe... 96 2e-19 ref|ZP_00182665.1| hypothetical protein Exigu202001 [Exiguobacte... 92 5e-18 ref|ZP_00129014.1| COG3695: Predicted methylated DNA-protein cys... 80 2e-14 ref|NP_455064.1| putative methylated-DNA methyltransferase [Salm... 77 2e-13 ref|NP_706349.1| orf, conserved hypothetical protein [Shigella f... 75 5e-13 >ref|NP_694070.1| hypothetical protein OB3148 [Oceanobacillus iheyensis HTE831] dbj|BAC15104.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 112 Score = 96.3 bits (238), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 49/88 (55%), Positives = 60/88 (68%), Gaps = 2/88 (2%) Query: 1 MTYGGIARAAGSPRAARQVVRILHSMSRKYKLPWHRVVNVKGEIALADDESSSLQRLYLL 60 MTYG IA AGS +AARQVVRILHSMS KY+LPWHRV+N +G+I + +E QR L Sbjct: 21 MTYGQIAANAGSKQAARQVVRILHSMSGKYQLPWHRVINAQGKIGIQSEEGFWEQRTRLE 80 Query: 61 GEGIVFDAKGVIDLQRYQYHP--EPDED 86 EG+ D G I L+ YQ+ P E +ED Sbjct: 81 SEGVKVDNHGKISLECYQWFPGKETEED 108 >ref|ZP_00182665.1| hypothetical protein Exigu202001 [Exiguobacterium sp. 255-15] Length = 75 Score = 91.7 bits (226), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 4/78 (5%) Query: 1 MTYGGIARAAGSPRAARQVVRILHSMSRKYKLPWHRVVNVKGEIALADDESSSLQRLYLL 60 MTYG +AR AG+PRAARQV ILHS+SR +LPW+RV+N KGEI+L DE Q+L L Sbjct: 1 MTYGQVARLAGNPRAARQVAWILHSLSRTEQLPWYRVLNAKGEISLDGDE----QQLALE 56 Query: 61 GEGIVFDAKGVIDLQRYQ 78 EGIVF+ G + L RYQ Sbjct: 57 AEGIVFERPGKLSLSRYQ 74 >ref|ZP_00129014.1| COG3695: Predicted methylated DNA-protein cysteine methyltransferase [Desulfovibrio desulfuricans G20] Length = 84 Score = 80.1 bits (196), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 40/78 (51%), Positives = 50/78 (64%) Query: 2 TYGGIARAAGSPRAARQVVRILHSMSRKYKLPWHRVVNVKGEIALADDESSSLQRLYLLG 61 TYG IA AG+PRAARQV R+LHS S + LPW+RV+N G I+L Q+ L Sbjct: 3 TYGMIAAMAGNPRAARQVARVLHSCSARDALPWYRVINAGGNISLPRGGGYERQKALLQR 62 Query: 62 EGIVFDAKGVIDLQRYQY 79 EGIVFD +DLQR+ + Sbjct: 63 EGIVFDETDRVDLQRFMW 80 >ref|NP_455064.1| putative methylated-DNA methyltransferase [Salmonella enterica subsp. enterica serovar Typhi] ref|NP_459462.1| putative methyltransferase [Salmonella typhimurium LT2] ref|NP_806123.1| putative methylated-DNA methyltransferase [Salmonella enterica subsp. enterica serovar Typhi Ty2] pir||AF0560 probable methylated-DNA methyltransferase ybaZ [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gb|AAL19421.1| putative methyltransferase [Salmonella typhimurium LT2] emb|CAD08926.1| putative methylated-DNA methyltransferase [Salmonella enterica subsp. enterica serovar Typhi] gb|AAO69983.1| putative methylated-DNA methyltransferase [Salmonella enterica subsp. enterica serovar Typhi Ty2] Length = 129 Score = 76.6 bits (187), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 41/78 (52%), Positives = 49/78 (62%), Gaps = 1/78 (1%) Query: 2 TYGGIARAAGSPRAARQVVRILHSMSRKYKLPWHRVVNVKGEIALADDESSSLQRLYLLG 61 TYG +AR AGSPRAARQV +L + LPWHRVVN G I+L + QR LL Sbjct: 51 TYGDVARLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGAISLTGPDLQR-QRQALLA 109 Query: 62 EGIVFDAKGVIDLQRYQY 79 EG+V G IDLQRY++ Sbjct: 110 EGVVVSGSGQIDLQRYRW 127 >ref|NP_706349.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] gb|AAN42056.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] Length = 136 Score = 75.1 bits (183), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 39/79 (49%), Positives = 50/79 (63%), Gaps = 1/79 (1%) Query: 2 TYGGIARAAGSPRAARQVVRILHSMSRKYKLPWHRVVNVKGEIALADDESSSLQRLYLLG 61 TYG +A+ AGSPRAARQV +L + LPWHRVVN G I+L + QR LL Sbjct: 58 TYGDVAKLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQR-QRQALLA 116 Query: 62 EGIVFDAKGVIDLQRYQYH 80 EG++ G IDLQRY+++ Sbjct: 117 EGVMVSGSGQIDLQRYRWN 135 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.319 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 141,221,916 Number of extensions: 4916733 Number of successful extensions: 10619 Number of sequences better than 1.0e-05: 38 Number of HSP's gapped: 10612 Number of HSP's successfully gapped: 38 Length of query: 93 Length of database: 757,237,578 Length adjustment: 61 Effective length of query: 32 Effective length of database: 591,616,539 Effective search space: 18931729248 Effective search space used: 18931729248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)