BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0236.0007.p (98 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_656908.1| DUF176, Uncharacterized ACR, YneC family COG135... 121 4e-27 ref|NP_979377.1| conserved hypothetical protein [Bacillus cereus... 120 8e-27 ref|NP_832769.1| hypothetical Cytosolic Protein [Bacillus cereus... 119 3e-26 ref|NP_388269.1| similar to hypothetical proteins [Bacillus subt... 93 2e-18 ref|ZP_00183036.1| hypothetical protein Exigu161001 [Exiguobacte... 89 3e-17 >ref|NP_656908.1| DUF176, Uncharacterized ACR, YneC family COG1359 [Bacillus anthracis A2012] ref|NP_845370.1| conserved hypothetical protein [Bacillus anthracis str. Ames] gb|AAP26856.1| conserved hypothetical protein [Bacillus anthracis str. Ames] Length = 97 Score = 121 bits (304), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 54/94 (57%), Positives = 71/94 (75%) Query: 1 MIIIHAVMQVNPALKEKFLAEAKQLLAATHQEEGNLSYELYNHFEQDNTYIMVETWRDME 60 MIIIHA+ QV+PA ++ FL E L+ ++ +E GN+SY+LY E++N Y MVE W+D E Sbjct: 1 MIIIHAIFQVDPAKQQSFLEEIHPLIHSSREESGNVSYDLYKDTEKENVYTMVEVWKDEE 60 Query: 61 AVASHNTSSHFTGFAAKAPEFLTAPLDVKVYNAE 94 AVASHNTS HFT F +KA ++LTAPLD+K YN E Sbjct: 61 AVASHNTSEHFTSFVSKAKQYLTAPLDIKAYNGE 94 >ref|NP_979377.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS41985.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 97 Score = 120 bits (302), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 53/94 (56%), Positives = 69/94 (73%) Query: 1 MIIIHAVMQVNPALKEKFLAEAKQLLAATHQEEGNLSYELYNHFEQDNTYIMVETWRDME 60 MIIIHA QV+PA ++ FL E + L+ ++ +E GN+SY+LY E++N Y MVE W+D Sbjct: 1 MIIIHATFQVDPAKQQTFLEEIRPLIHSSREESGNISYDLYKDIEKENVYTMVEVWKDEA 60 Query: 61 AVASHNTSSHFTGFAAKAPEFLTAPLDVKVYNAE 94 AVASHNTS HFT F +K +FLTAPLD+K YN E Sbjct: 61 AVASHNTSEHFTSFVSKVKQFLTAPLDIKAYNGE 94 >ref|NP_832769.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] gb|AAP09970.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] Length = 97 Score = 119 bits (297), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 53/94 (56%), Positives = 70/94 (74%) Query: 1 MIIIHAVMQVNPALKEKFLAEAKQLLAATHQEEGNLSYELYNHFEQDNTYIMVETWRDME 60 MIIIHA+ QV+PA ++ FL E + L+ + +E GN+SY+LY E+++ Y MVE W+D Sbjct: 1 MIIIHAIFQVDPAKQQAFLEEIQPLIHGSREESGNVSYDLYKDTEKESVYTMVEVWKDEA 60 Query: 61 AVASHNTSSHFTGFAAKAPEFLTAPLDVKVYNAE 94 AVASHNTS HFT F +KA +FLTAPLD+K YN E Sbjct: 61 AVASHNTSEHFTSFVSKAAQFLTAPLDIKAYNGE 94 >ref|NP_388269.1| similar to hypothetical proteins [Bacillus subtilis] sp|P94425|YCNE_BACSU Hypothetical protein ycnE pir||A69764 conserved hypothetical protein ycnE - Bacillus subtilis dbj|BAA09019.1| ycnE [Bacillus subtilis] emb|CAB12195.1| ycnE [Bacillus subtilis subsp. subtilis str. 168] Length = 95 Score = 92.8 bits (229), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 39/88 (44%), Positives = 61/88 (69%) Query: 1 MIIIHAVMQVNPALKEKFLAEAKQLLAATHQEEGNLSYELYNHFEQDNTYIMVETWRDME 60 MI++ A ++V P +E+FL+EA+ L+ + EEGN Y+L+ ++NT++M+E W+D Sbjct: 1 MIVLQAYIKVKPEKREEFLSEAQSLVQHSRAEEGNAQYDLFEKVGEENTFVMLEKWKDEA 60 Query: 61 AVASHNTSSHFTGFAAKAPEFLTAPLDV 88 A+ HN ++HF GF AK E L+APLDV Sbjct: 61 AMKFHNETAHFQGFVAKGKELLSAPLDV 88 >ref|ZP_00183036.1| hypothetical protein Exigu161001 [Exiguobacterium sp. 255-15] Length = 93 Score = 89.0 bits (219), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 40/93 (43%), Positives = 59/93 (63%) Query: 1 MIIIHAVMQVNPALKEKFLAEAKQLLAATHQEEGNLSYELYNHFEQDNTYIMVETWRDME 60 MI I A ++V PA +++FL K L+ + E GN+SY+L+ E +N ++M+E W D Sbjct: 1 MIAIEAKLEVQPAKRQEFLEATKTLIEGSRLEAGNISYDLFQSIEDENVFMMIEKWEDQA 60 Query: 61 AVASHNTSSHFTGFAAKAPEFLTAPLDVKVYNA 93 A+ +HNTS+HF F A A L PLDV+ +NA Sbjct: 61 AIETHNTSAHFGQFVAFAQTALAKPLDVQSFNA 93 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.127 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 139,832,455 Number of extensions: 4656379 Number of successful extensions: 11674 Number of sequences better than 1.0e-05: 31 Number of HSP's gapped: 11686 Number of HSP's successfully gapped: 31 Length of query: 98 Length of database: 757,237,578 Length adjustment: 66 Effective length of query: 32 Effective length of database: 578,041,044 Effective search space: 18497313408 Effective search space used: 18497313408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)