BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0234.0004.p (97 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_371815.1| conserved hypothetical protein [Staphylococcus ... 109 2e-23 ref|NP_645991.1| conserved hypothetical protein [Staphylococcus ... 109 2e-23 ref|NP_764525.1| conserved hypothetical protein [Staphylococcus ... 108 4e-23 ref|ZP_00060975.1| COG0011: Uncharacterized conserved protein [C... 91 8e-18 ref|NP_976817.1| conserved hypothetical protein [Bacillus cereus... 87 1e-16 >ref|NP_371815.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374407.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] pir||F89903 conserved hypothetical protein SA1133 [imported] - Staphylococcus aureus (strain N315) dbj|BAB42386.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB57453.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] Length = 97 Score = 109 bits (272), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 48/95 (50%), Positives = 75/95 (78%) Query: 1 MANTLLSIQVIPKTPNNEDSIPYVDKAIEVIQQSGVKHQVNPLETTMEGELSELLEVVRH 60 M +TL+SIQ+IPKTPNN++ IPYVD+AI++I +SG+ +V PLETT++G ++E L +++ Sbjct: 1 MKDTLMSIQIIPKTPNNDNVIPYVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQS 60 Query: 61 MHEALIASGSPSVISQIKIAHNPSGISMDKLTEKY 95 ++E ++ PS+ISQ+K H P GI+++ LTEKY Sbjct: 61 LNERMVELECPSIISQVKFYHVPDGITIETLTEKY 95 >ref|NP_645991.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] dbj|BAB95039.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 97 Score = 109 bits (272), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 48/95 (50%), Positives = 75/95 (78%) Query: 1 MANTLLSIQVIPKTPNNEDSIPYVDKAIEVIQQSGVKHQVNPLETTMEGELSELLEVVRH 60 M +TL+SIQ+IPKTPNN++ IPYVD+AI++I +SG+ +V PLETT++G ++E L +++ Sbjct: 1 MKDTLMSIQIIPKTPNNDNVIPYVDEAIKIIDESGMHFRVGPLETTVQGNMNECLILIQS 60 Query: 61 MHEALIASGSPSVISQIKIAHNPSGISMDKLTEKY 95 ++E ++ PS+ISQ+K H P GI+++ LTEKY Sbjct: 61 LNERMVELECPSIISQVKFYHVPDGITIETLTEKY 95 >ref|NP_764525.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] gb|AAO04567.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] Length = 96 Score = 108 bits (270), Expect = 4e-23, Method: Compositional matrix adjust. Identities = 49/95 (51%), Positives = 72/95 (75%) Query: 1 MANTLLSIQVIPKTPNNEDSIPYVDKAIEVIQQSGVKHQVNPLETTMEGELSELLEVVRH 60 M +TL+SIQ+IPKTPNN D IPYVD+AI++I SG+ +V PLETT++GE+SE L +++ Sbjct: 1 MQDTLMSIQIIPKTPNNNDVIPYVDEAIKIIDDSGLHFRVGPLETTVQGEMSECLILIQK 60 Query: 61 MHEALIASGSPSVISQIKIAHNPSGISMDKLTEKY 95 +++ ++ PS+ISQ+K H P GI ++ LT KY Sbjct: 61 LNDRMVELECPSIISQVKFYHVPEGIEIETLTGKY 95 >ref|ZP_00060975.1| COG0011: Uncharacterized conserved protein [Clostridium thermocellum ATCC 27405] Length = 95 Score = 90.9 bits (224), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 44/96 (45%), Positives = 65/96 (67%), Gaps = 1/96 (1%) Query: 1 MANTLLSIQVIPKTPNNEDSIPYVDKAIEVIQQSGVKHQVNPLETTMEGELSELLEVVRH 60 MA +S+QVIP P N+ P VDK I++I +SGVK++V P+ETTMEG++ LLE+V+ Sbjct: 1 MAAVNVSLQVIPCVPENQ-IYPVVDKVIDLIAKSGVKYEVGPMETTMEGDIDTLLEIVKK 59 Query: 61 MHEALIASGSPSVISQIKIAHNPSGISMDKLTEKYR 96 E I+ G+ V+S +KI + G++MD+ KYR Sbjct: 60 AQEICISEGASRVLSVVKIDYKKEGVTMDEKISKYR 95 >ref|NP_976817.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] gb|AAS39425.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] Length = 106 Score = 86.7 bits (213), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 41/92 (44%), Positives = 65/92 (70%), Gaps = 2/92 (2%) Query: 6 LSIQVIPKTPNNEDSIPYVDKAIEVIQQSGVKHQVNPLETTMEGELSELLEVVRHMHEAL 65 +S V+P+ N+D VDKAIEV+QQSGV+++V +ETT+EGEL LL++++ +A Sbjct: 7 ISFSVVPQ-AKNKDVYSVVDKAIEVVQQSGVRYEVGAMETTLEGELDVLLDIIKRAQQAC 65 Query: 66 IASGSPSVISQIKIAHNPS-GISMDKLTEKYR 96 + +G+ VI+ IKI + PS G+++D+ KYR Sbjct: 66 VDAGAEEVITSIKIHYRPSTGVTIDEKVWKYR 97 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.310 0.128 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 134,325,230 Number of extensions: 4336560 Number of successful extensions: 12107 Number of sequences better than 1.0e-05: 16 Number of HSP's gapped: 12116 Number of HSP's successfully gapped: 16 Length of query: 97 Length of database: 757,237,578 Length adjustment: 65 Effective length of query: 32 Effective length of database: 580,756,143 Effective search space: 18584196576 Effective search space used: 18584196576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 120 (50.8 bits)