BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0231.0055.p (119 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_390763.1| ribosomal protein L20 [Bacillus subtilis] >gi|2... 179 1e-44 ref|NP_244004.1| 50S ribosomal protein L20; ribosomal protein L2... 176 1e-43 sp|P13070|RL20_BACST 50S ribosomal protein L20 >gi|71270|pir||R5... 174 4e-43 ref|NP_658602.1| Ribosomal_L20, Ribosomal protein L20 [Bacillus ... 173 1e-42 ref|NP_721125.1| 50S ribosomal protein L20 [Streptococcus mutans... 172 3e-42 >ref|NP_390763.1| ribosomal protein L20 [Bacillus subtilis] sp|P55873|RL20_BACSU 50S ribosomal protein L20 pir||F69696 ribosomal protein L20 rplT - Bacillus subtilis emb|CAA99618.1| ribosomal protein L20 [Bacillus subtilis] emb|CAB14845.1| ribosomal protein L20 [Bacillus subtilis subsp. subtilis str. 168] Length = 119 Score = 179 bits (455), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 87/118 (73%), Positives = 102/118 (86%) Query: 1 MARVKGGFVVRRRHKKVLKLARGYFGSKHRIFKTANEQVMKSMLYAYRDRRQTKRNFRRL 60 M RVKGG V R+R KKVLKLA+GYFGSKH ++K AN+QVMKS YA+RDRRQ KR+FR+L Sbjct: 1 MPRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRRQKKRDFRKL 60 Query: 61 WIVRINAAARLNGLSYSKLVFGLKLAGVEVNRKMLADLAVNDLNAFNSLAVVAKEKIN 118 WI RINAAAR+NGLSYS+L+ GLKL+G+EVNRKMLADLAVNDL AFN LA AK ++N Sbjct: 61 WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLTAFNQLADAAKAQLN 118 >ref|NP_244004.1| 50S ribosomal protein L20; ribosomal protein L20 [Bacillus halodurans] sp|Q9K869|RL20_BACHD 50S ribosomal protein L20 pir||B84042 ribosomal protein L20 rplT [imported] - Bacillus halodurans (strain C-125) dbj|BAB06857.1| 50S ribosomal protein L20 [Bacillus halodurans] Length = 119 Score = 176 bits (447), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 87/118 (73%), Positives = 99/118 (83%) Query: 1 MARVKGGFVVRRRHKKVLKLARGYFGSKHRIFKTANEQVMKSMLYAYRDRRQTKRNFRRL 60 M RVKGG+V RRR KKVLKLA+GYFGSKH +FK+A QVMKS+ YAYRDRRQ KR+FR+L Sbjct: 1 MPRVKGGYVARRRRKKVLKLAKGYFGSKHTLFKSAQGQVMKSLQYAYRDRRQKKRDFRKL 60 Query: 61 WIVRINAAARLNGLSYSKLVFGLKLAGVEVNRKMLADLAVNDLNAFNSLAVVAKEKIN 118 WI RINAAARLNGLSYS+L+ GLKLAG+ VNRKMLADLA+ND AF LA AK +N Sbjct: 61 WITRINAAARLNGLSYSRLMHGLKLAGINVNRKMLADLAINDEKAFAQLAEKAKASLN 118 >sp|P13070|RL20_BACST 50S ribosomal protein L20 pir||R5BS20 ribosomal protein L20 - Bacillus stearothermophilus emb|CAA34314.1| unnamed protein product [Geobacillus stearothermophilus] Length = 119 Score = 174 bits (442), Expect = 4e-43, Method: Compositional matrix adjust. Identities = 86/118 (72%), Positives = 102/118 (86%) Query: 1 MARVKGGFVVRRRHKKVLKLARGYFGSKHRIFKTANEQVMKSMLYAYRDRRQTKRNFRRL 60 M RVKGG V RRR KKVLKLA+GYFG+KH +++ AN+QVMKS++YAYRDRRQ KR+FR+L Sbjct: 1 MPRVKGGPVTRRRRKKVLKLAKGYFGAKHALYRVANQQVMKSLMYAYRDRRQRKRDFRKL 60 Query: 61 WIVRINAAARLNGLSYSKLVFGLKLAGVEVNRKMLADLAVNDLNAFNSLAVVAKEKIN 118 WIVRINAAAR NGLSYS+L+ GLKLAGVEVNRK++ADLAVND AF LA +AK +N Sbjct: 61 WIVRINAAARQNGLSYSRLMHGLKLAGVEVNRKIVADLAVNDQAAFAQLADLAKANLN 118 >ref|NP_658602.1| Ribosomal_L20, Ribosomal protein L20 [Bacillus anthracis A2012] ref|NP_834279.1| LSU ribosomal protein L20P [Bacillus cereus ATCC 14579] ref|NP_847020.1| ribosomal protein L20 [Bacillus anthracis str. Ames] ref|NP_980997.1| ribosomal protein L20 [Bacillus cereus ATCC 10987] sp|Q817H7|RL20_BACCR 50S ribosomal protein L20 sp|Q81L17|RL20_BACAA 50S ribosomal protein L20 gb|AAP11480.1| LSU ribosomal protein L20P [Bacillus cereus ATCC 14579] gb|AAP28506.1| ribosomal protein L20 [Bacillus anthracis str. Ames] gb|AAS43605.1| ribosomal protein L20 [Bacillus cereus ATCC 10987] Length = 118 Score = 173 bits (438), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 84/118 (71%), Positives = 101/118 (85%) Query: 1 MARVKGGFVVRRRHKKVLKLARGYFGSKHRIFKTANEQVMKSMLYAYRDRRQTKRNFRRL 60 M RVKGG V R+R KKV+KLA+GY+GSK+ +FK AN+QVMKS++YA+RDRRQ KR+FR+L Sbjct: 1 MPRVKGGTVTRQRRKKVIKLAKGYYGSKNTLFKVANQQVMKSLMYAFRDRRQKKRDFRKL 60 Query: 61 WIVRINAAARLNGLSYSKLVFGLKLAGVEVNRKMLADLAVNDLNAFNSLAVVAKEKIN 118 WI RINAAAR+NGLSYS+L+ GLK AG+EVNRKMLADLAV+D AF LA VAK IN Sbjct: 61 WITRINAAARMNGLSYSRLMHGLKNAGIEVNRKMLADLAVHDEKAFAELATVAKNNIN 118 >ref|NP_721125.1| 50S ribosomal protein L20 [Streptococcus mutans UA159] sp|Q8DV20|RL20_STRMU 50S ribosomal protein L20 gb|AAN58431.1| 50S ribosomal protein L20 [Streptococcus mutans UA159] Length = 119 Score = 172 bits (435), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 86/117 (73%), Positives = 99/117 (84%) Query: 1 MARVKGGFVVRRRHKKVLKLARGYFGSKHRIFKTANEQVMKSMLYAYRDRRQTKRNFRRL 60 MARVKGG V R+R K+VLKLA+GY+G+KH +F+TA EQVM S YAYRDRRQ KR+FR+L Sbjct: 1 MARVKGGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQRKRDFRKL 60 Query: 61 WIVRINAAARLNGLSYSKLVFGLKLAGVEVNRKMLADLAVNDLNAFNSLAVVAKEKI 117 WI RINAAAR+NGLSYS+L+ GLKLA VEVNRKMLADLAVND AF LA AKEK+ Sbjct: 61 WITRINAAARMNGLSYSQLMHGLKLAEVEVNRKMLADLAVNDAAAFTVLADAAKEKL 117 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.327 0.137 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 143,278,673 Number of extensions: 4411798 Number of successful extensions: 14531 Number of sequences better than 1.0e-05: 660 Number of HSP's gapped: 14505 Number of HSP's successfully gapped: 660 Length of query: 119 Length of database: 757,237,578 Length adjustment: 84 Effective length of query: 35 Effective length of database: 529,169,262 Effective search space: 18520924170 Effective search space used: 18520924170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 120 (50.8 bits)