BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0231.0054.p (63 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_625875.1| 50S ribosomal protein L35 [Streptomyces coelico... 67 2e-10 ref|NP_827914.1| putative ribosomal protein L35 [Streptomyces av... 66 2e-10 ref|NP_390764.1| ribosomal protein L35 [Bacillus subtilis] >gi|2... 59 4e-08 sp|P13069|RL35_BACST 50S ribosomal protein L35 >gi|71371|pir||R5... 54 1e-06 ref|NP_658603.1| Ribosomal_L35p, Ribosomal protein L35 [Bacillus... 54 1e-06 >ref|NP_625875.1| 50S ribosomal protein L35 [Streptomyces coelicolor A3(2)] sp|O88059|RL35_STRCO 50S ribosomal protein L35 pir||T36834 ribosomal protein L35 - Streptomyces coelicolor emb|CAA20810.1| 50S ribosomal protein L35 [Streptomyces coelicolor A3(2)] Length = 64 Score = 66.6 bits (161), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 34/56 (60%), Positives = 39/56 (69%) Query: 2 KTHSSLKGRFKITGSGKVLRYKAHKNHLLSHKSKRAKRVLNGNPVMAPGDVRRLKQ 57 K+HS RFKITGSGKVLR +A K HLL HKS R R L GN MAPGD ++K+ Sbjct: 5 KSHSGASKRFKITGSGKVLRERAGKRHLLEHKSSRVTRRLTGNAEMAPGDAAKIKK 60 >ref|NP_827914.1| putative ribosomal protein L35 [Streptomyces avermitilis MA-4680] dbj|BAC74449.1| putative ribosomal protein L35 [Streptomyces avermitilis MA-4680] Length = 64 Score = 66.2 bits (160), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 33/56 (58%), Positives = 40/56 (71%) Query: 2 KTHSSLKGRFKITGSGKVLRYKAHKNHLLSHKSKRAKRVLNGNPVMAPGDVRRLKQ 57 K+HS RFK+TGSGKVLR +A K HLL HKS R R L GN MAPGD +++K+ Sbjct: 5 KSHSGASKRFKVTGSGKVLRERAGKRHLLEHKSSRLTRRLTGNAEMAPGDAKKIKK 60 >ref|NP_390764.1| ribosomal protein L35 [Bacillus subtilis] sp|P55874|RL35_BACSU 50S ribosomal protein L35 pir||C69698 ribosomal protein L35 rpmI - Bacillus subtilis emb|CAA99617.1| ribosomal protein L35 [Bacillus subtilis] emb|CAB14846.1| ribosomal protein L35 [Bacillus subtilis subsp. subtilis str. 168] Length = 66 Score = 58.5 bits (140), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 31/63 (49%), Positives = 44/63 (69%) Query: 1 MKTHSSLKGRFKITGSGKVLRYKAHKNHLLSHKSKRAKRVLNGNPVMAPGDVRRLKQGLA 60 MKTH RFK TGSGK+ R A+ +HL ++KS++ KR L + V++ GD +R+KQ LA Sbjct: 4 MKTHRGSAKRFKKTGSGKLKRSHAYTSHLFANKSQKQKRKLRKSAVVSAGDFKRIKQMLA 63 Query: 61 NLK 63 N+K Sbjct: 64 NIK 66 >sp|P13069|RL35_BACST 50S ribosomal protein L35 pir||R5BS35 ribosomal protein L35 - Bacillus stearothermophilus emb|CAA34313.1| unnamed protein product [Geobacillus stearothermophilus] Length = 66 Score = 53.9 bits (128), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 29/63 (46%), Positives = 42/63 (66%) Query: 1 MKTHSSLKGRFKITGSGKVLRYKAHKNHLLSHKSKRAKRVLNGNPVMAPGDVRRLKQGLA 60 MKTH RFK T SGK+ R A+ +HL ++K+K+ KR L +++PGD +R++Q L Sbjct: 4 MKTHRGSAKRFKKTASGKLKRGHAYTSHLFANKTKKQKRHLRKATLVSPGDFKRIRQMLD 63 Query: 61 NLK 63 NLK Sbjct: 64 NLK 66 >ref|NP_658603.1| Ribosomal_L35p, Ribosomal protein L35 [Bacillus anthracis A2012] ref|NP_834280.1| LSU ribosomal protein L35P [Bacillus cereus ATCC 14579] ref|NP_847021.1| ribosomal protein L35 [Bacillus anthracis str. Ames] ref|NP_980998.1| ribosomal protein L35 [Bacillus cereus ATCC 10987] gb|AAP11481.1| LSU ribosomal protein L35P [Bacillus cereus ATCC 14579] gb|AAP28507.1| ribosomal protein L35 [Bacillus anthracis str. Ames] gb|AAS43606.1| ribosomal protein L35 [Bacillus cereus ATCC 10987] Length = 66 Score = 53.9 bits (128), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 30/62 (48%), Positives = 41/62 (66%) Query: 2 KTHSSLKGRFKITGSGKVLRYKAHKNHLLSHKSKRAKRVLNGNPVMAPGDVRRLKQGLAN 61 KTH RFK TGSGK+ R A+ +HL ++KS +AKR L V++ GD +R++Q L N Sbjct: 5 KTHRGAAKRFKKTGSGKLKRSHAYTSHLFANKSTKAKRKLRKAGVVSAGDFKRIRQMLDN 64 Query: 62 LK 63 LK Sbjct: 65 LK 66 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 91,512,100 Number of extensions: 2722712 Number of successful extensions: 7203 Number of sequences better than 1.0e-05: 23 Number of HSP's gapped: 7222 Number of HSP's successfully gapped: 23 Length of query: 63 Length of database: 757,237,578 Length adjustment: 35 Effective length of query: 28 Effective length of database: 662,209,113 Effective search space: 18541855164 Effective search space used: 18541855164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)