BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0231.0019.p (171 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_782891.1| putative phosphoesterase [Clostridium tetani E8... 137 9e-32 ref|ZP_00060299.1| COG0622: Predicted phosphoesterase [Clostridi... 131 6e-30 ref|NP_625050.1| conserved hypothetical protein SCF81.06c [Strep... 103 1e-21 ref|NP_247607.1| conserved hypothetical protein [Methanococcus j... 102 3e-21 ref|NP_276880.1| conserved protein [Methanothermobacter thermaut... 100 1e-20 >ref|NP_782891.1| putative phosphoesterase [Clostridium tetani E88] gb|AAO36828.1| putative phosphoesterase [Clostridium tetani E88] Length = 167 Score = 137 bits (345), Expect = 9e-32, Method: Compositional matrix adjust. Identities = 64/167 (38%), Positives = 104/167 (62%), Gaps = 2/167 (1%) Query: 4 MKVGVVSDTHLSSRAKGLPSVLMEEFSKVDMILHLGDWVSLEIYDLLAELAPVEGIAGNN 63 MK+G++SDTH++ + + + +L + F VD I+H+GD+ SLE+ + G+ GNN Sbjct: 3 MKIGIISDTHVTKKVENIDKLLKDYFYDVDTIVHVGDFNSLEVIKRIKNKKKFIGVYGNN 62 Query: 64 DGAEIIRRFGERKIVTLEGVRIGMIHGHAPYSRKGTDGNALLAFEGEKVDCILFGHSHQP 123 D +I + I+ +EG +IG+ HGH K T A F+ EKVD I+FGHSHQP Sbjct: 63 DSKDIKGVLPMKDIIKIEGYKIGLFHGHG--GSKNTLDRAYDEFKDEKVDIIIFGHSHQP 120 Query: 124 LLRQEGDILLFNPGSPTDKRREKQYSFGLMDIEEGKISARHIFYDSR 170 +++ IL+ NPGSPT K +E+ YS+ L+++++ KI A+ + + + Sbjct: 121 IIKTRNKILMINPGSPTRKLKERWYSYVLLELDKKKIEAKMVLFKKK 167 >ref|ZP_00060299.1| COG0622: Predicted phosphoesterase [Clostridium thermocellum ATCC 27405] Length = 161 Score = 131 bits (330), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 67/159 (42%), Positives = 95/159 (59%), Gaps = 3/159 (1%) Query: 4 MKVGVVSDTHLSSRAKGLPSVLMEEFSKVDMILHLGDWVSLEIYDLLAELAPVEGIAGNN 63 M +GVVSDTH+ R K LP L++ VD+I+H GD + + L E+APVE +AGNN Sbjct: 1 MIIGVVSDTHVGGRIKSLPKELLDGLRGVDLIIHAGDILKDFVIYELEEIAPVEAVAGNN 60 Query: 64 DGAEIIRRFGERKIVTLEGVRIGMIHGHAPYSRKGTDGNALLAFEGEKVDCILFGHSHQP 123 D + + G +KI+ +IG+ HG Y A+ F + VDC++FGHSH P Sbjct: 61 DDYYMQHKLGVKKIINAGKFKIGITHG---YGGVNALKKAMATFARDSVDCVVFGHSHAP 117 Query: 124 LLRQEGDILLFNPGSPTDKRREKQYSFGLMDIEEGKISA 162 + +L NPGSPTDKR +KQYS+ L+ +++ ISA Sbjct: 118 YNERIDGVLYVNPGSPTDKRFQKQYSYALLKVDDSGISA 156 >ref|NP_625050.1| conserved hypothetical protein SCF81.06c [Streptomyces coelicolor A3(2)] emb|CAB61557.1| conserved hypothetical protein SCF81.06c [Streptomyces coelicolor A3(2)] Length = 166 Score = 103 bits (258), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 58/159 (36%), Positives = 87/159 (54%), Gaps = 6/159 (3%) Query: 4 MKVGVVSDTHLSSRAKGLPSVLMEEFSKVDMILHLGDWVSLEIYDLLAELA-PVEGIAGN 62 M++ + SDTHL RAK LP+ L+ E + D++LH GDWV DLL + + G+ GN Sbjct: 1 MRLLITSDTHLPKRAKELPAPLLAEIPRADVVLHAGDWVDTATLDLLESRSRRLVGVHGN 60 Query: 63 NDGAEIIRRFGERKIVTLEGVRIGMIHGHAPYSRKGTDGNALLAFEGEKVDCILFGHSHQ 122 NDG + R E L G+R G++H + +G + F G +D ++FGHSH Sbjct: 61 NDGPALRARLPEVAYADLGGLRFGVVHETG--AAQGREARCAARFPG--LDLLVFGHSHI 116 Query: 123 PLLRQEGDIL-LFNPGSPTDKRREKQYSFGLMDIEEGKI 160 P L L NPGSPTD+RR+ ++ + +G++ Sbjct: 117 PWDTTAATGLRLLNPGSPTDRRRQPYRTYLTATVADGRL 155 >ref|NP_247607.1| conserved hypothetical protein [Methanococcus jannaschii] sp|Q58040|Y623_METJA Hypothetical protein MJ0623 pir||G64377 VPS29-like phosphoesterase-related protein MJ0623 [similarity] - Methanococcus jannaschii gb|AAB98618.1| conserved hypothetical protein [Methanococcus jannaschii] Length = 192 Score = 102 bits (254), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 60/141 (42%), Positives = 80/141 (56%), Gaps = 5/141 (3%) Query: 3 QMKVGVVSDTHLSSRAKGLPSVLMEEFSKVDMILHLGDWVSLEIYDLLAELAPVEGIAGN 62 M +GV+SDTHL RA LP + +EFS VD+I+H GD EI D L +LA V + GN Sbjct: 33 TMLIGVISDTHLYDRAFELPKAVFDEFSNVDLIIHCGDVTDKEILDSLKDLAKVVAVKGN 92 Query: 63 NDGAEIIRRFGERKIVTLEGVRIGMIHGHAPYSRKGTDGNALLAFEGEKVDCILFGHSHQ 122 D + R ++I+ + ++IG+IHG Y R LL E VD ++ GH+H Sbjct: 93 MDYLNLPR----KEILEINDIKIGVIHGDVVYPRGDRLKLRLLGKE-MGVDVLISGHTHT 147 Query: 123 PLLRQEGDILLFNPGSPTDKR 143 P + DILL NPGSPT R Sbjct: 148 PFIDDCRDILLLNPGSPTVPR 168 >ref|NP_276880.1| conserved protein [Methanothermobacter thermautotrophicus] sp|O27802|YH74_METTH Hypothetical protein MJ1774 pir||H69103 VPS29-like phosphoesterase-related protein MTH1774 [similarity] - Methanobacterium thermoautotrophicum (strain Delta H) gb|AAB86240.1| conserved protein [Methanothermobacter thermautotrophicus str. Delta H] Length = 172 Score = 100 bits (249), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 58/143 (40%), Positives = 80/143 (55%), Gaps = 9/143 (6%) Query: 4 MKVGVVSDTHLSSRAKGLPSVLMEEFSKVDMILHLGDWVSLEIYDLLAELAPVEGIAGNN 63 M +GV+SDTH+ RA +P + + F V++ILH GD S +I L LAPVE + GN Sbjct: 1 MLIGVISDTHIPDRASEIPEAVFDAFRDVELILHAGDLTSPDILTELETLAPVECVQGNM 60 Query: 64 D---GAEIIRRFGERKIVTLEGVRIGMIHGHAPYSRKGTDGNALLAFEGEKVDCILFGHS 120 D G E R ++ +E R+G+IHG Y R T L E D ++ GH+ Sbjct: 61 DRHYGIETPR----SRLFEIESFRVGLIHGEV-YPRGDTQQLRYLGLE-LGADVLISGHT 114 Query: 121 HQPLLRQEGDILLFNPGSPTDKR 143 HQP +R+ D++L NPGSPT R Sbjct: 115 HQPFIRELEDMVLLNPGSPTVPR 137 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.140 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 260,911,458 Number of extensions: 10679051 Number of successful extensions: 21245 Number of sequences better than 1.0e-05: 78 Number of HSP's gapped: 21203 Number of HSP's successfully gapped: 78 Length of query: 171 Length of database: 757,237,578 Length adjustment: 117 Effective length of query: 54 Effective length of database: 439,570,995 Effective search space: 23736833730 Effective search space used: 23736833730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 121 (51.2 bits)