BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0231.0014.p (101 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_244169.1| BH3303~unknown conserved protein in bacilli [Ba... 129 2e-29 ref|NP_833124.1| Transcriptional regulator, MarR family [Bacillu... 128 4e-29 ref|NP_391248.1| similar to hypothetical proteins [Bacillus subt... 120 1e-26 gb|AAB91592.1| Orf1 [Bacillus subtilis] 118 5e-26 ref|NP_693965.1| hypothetical protein OB3043 [Oceanobacillus ihe... 115 4e-25 >ref|NP_244169.1| BH3303~unknown conserved protein in bacilli [Bacillus halodurans] pir||T44493 conserved hypothetical protein YVAP [imported] - Bacillus halodurans dbj|BAA83951.1| YVAP [Bacillus halodurans] dbj|BAB07022.1| BH3303~unknown conserved protein in bacilli [Bacillus halodurans] Length = 107 Score = 129 bits (325), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 60/92 (65%), Positives = 77/92 (83%) Query: 1 MDIIGRRWTGLIIYQLLQGPQRFSVIEAALPVSGRLLSERLKELEQEGIVLREVFPETPV 60 + I+ +RWTGLIIYQLL GPQRF IE++LP+SGR+LSERLK+LEQ GIV R+V+PETPV Sbjct: 14 ITILSQRWTGLIIYQLLSGPQRFRAIESSLPISGRVLSERLKDLEQHGIVKRDVYPETPV 73 Query: 61 RIQYSLTDKGRALESVIRDLQQWSDSWITAEE 92 RI+YSLT+KG ALE V++ ++ WS W+ EE Sbjct: 74 RIEYSLTEKGLALEPVLKKVEAWSQEWLDVEE 105 >ref|NP_833124.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] gb|AAP10325.1| Transcriptional regulator, MarR family [Bacillus cereus ATCC 14579] Length = 105 Score = 128 bits (321), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 62/92 (67%), Positives = 73/92 (79%) Query: 1 MDIIGRRWTGLIIYQLLQGPQRFSVIEAALPVSGRLLSERLKELEQEGIVLREVFPETPV 60 M +RWT LIIYQL G QRF +E++LPVSGRLLSERLKELE EGIV R+VFPETPV Sbjct: 14 MKFFSQRWTALIIYQLFSGSQRFCTLESSLPVSGRLLSERLKELELEGIVERKVFPETPV 73 Query: 61 RIQYSLTDKGRALESVIRDLQQWSDSWITAEE 92 RI+YSLT KG ALE++IR +++WS WI EE Sbjct: 74 RIEYSLTQKGFALEAIIRGIEEWSQEWIELEE 105 >ref|NP_391248.1| similar to hypothetical proteins [Bacillus subtilis] pir||E70028 conserved hypothetical protein yvaP - Bacillus subtilis emb|CAB15373.1| yvaP [Bacillus subtilis subsp. subtilis str. 168] Length = 236 Score = 120 bits (301), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 56/89 (62%), Positives = 73/89 (82%), Gaps = 1/89 (1%) Query: 1 MDIIGRRWTGLIIYQLLQGPQRFSVIEAALP-VSGRLLSERLKELEQEGIVLREVFPETP 59 +DI+ +RW LI++QLL G QRFS IEAALP +SGR+LSERLKELE EG+V R+V PETP Sbjct: 97 VDILSKRWVALIVFQLLNGSQRFSEIEAALPNLSGRVLSERLKELELEGVVKRDVIPETP 156 Query: 60 VRIQYSLTDKGRALESVIRDLQQWSDSWI 88 VRI+YSLTDKG+AL ++ ++ +W+ WI Sbjct: 157 VRIEYSLTDKGKALAPILGEISKWATEWI 185 >gb|AAB91592.1| Orf1 [Bacillus subtilis] Length = 108 Score = 118 bits (295), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 56/89 (62%), Positives = 73/89 (82%), Gaps = 1/89 (1%) Query: 1 MDIIGRRWTGLIIYQLLQGPQRFSVIEAALP-VSGRLLSERLKELEQEGIVLREVFPETP 59 +DI+ +RW LI++QLL G QRFS IEAALP +SGR+LSERLKELE EG+V R+V PETP Sbjct: 14 VDILSKRWVALIVFQLLNGSQRFSEIEAALPNLSGRVLSERLKELELEGVVKRDVIPETP 73 Query: 60 VRIQYSLTDKGRALESVIRDLQQWSDSWI 88 VRI+YSLTDKG+AL ++ ++ +W+ WI Sbjct: 74 VRIEYSLTDKGKALAPILGEISKWATDWI 102 >ref|NP_693965.1| hypothetical protein OB3043 [Oceanobacillus iheyensis HTE831] dbj|BAC14999.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 108 Score = 115 bits (288), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 52/94 (55%), Positives = 78/94 (82%) Query: 1 MDIIGRRWTGLIIYQLLQGPQRFSVIEAALPVSGRLLSERLKELEQEGIVLREVFPETPV 60 M ++ RW GLI+++LL+G +RFS +EA LP+SGRLLS+RLK LE++GIV R ++ E PV Sbjct: 13 MGLLSTRWVGLILFELLKGAKRFSEMEADLPISGRLLSDRLKLLEKQGIVERNIYSEFPV 72 Query: 61 RIQYSLTDKGRALESVIRDLQQWSDSWITAEECQ 94 RI+YSL+ KG++LE VI+++Q+W+D +I+AEE + Sbjct: 73 RIEYSLSPKGKSLEPVIQEIQKWADEYISAEEVE 106 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 144,194,437 Number of extensions: 4878591 Number of successful extensions: 16677 Number of sequences better than 1.0e-05: 294 Number of HSP's gapped: 16501 Number of HSP's successfully gapped: 296 Length of query: 101 Length of database: 757,237,578 Length adjustment: 68 Effective length of query: 33 Effective length of database: 572,610,846 Effective search space: 18896157918 Effective search space used: 18896157918 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)