BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0225.0014.p (131 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC62421.1| hypothetical protein [Bacillus firmus] 118 4e-26 ref|NP_242030.1| transcriptional regulator (GntR family) [Bacill... 113 2e-24 ref|NP_781465.1| transcriptional regulator, gntR family [Clostri... 82 4e-15 ref|NP_656917.1| HTH_GNTR, helix_turn_helix gluconate operon tra... 82 4e-15 ref|ZP_00120508.1| COG1725: Predicted transcriptional regulators... 82 4e-15 >gb|AAC62421.1| hypothetical protein [Bacillus firmus] Length = 119 Score = 118 bits (296), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 56/119 (47%), Positives = 80/119 (67%) Query: 1 MWIPIQINENSAEPLYHQIETQLKSLIISGVITEGTLLPSIREFAGDLKCSVITVRRVYQ 60 M +PI + E S P+YHQIE Q+K+LI+SG ++ GT LPSIR + DL CSVIT RR YQ Sbjct: 1 MKLPISVQEGSRTPIYHQIEEQIKALIVSGHVSAGTPLPSIRALSKDLACSVITTRRAYQ 60 Query: 61 DLENEGLLRTRQGTGTFVSHVGEGAMEGYKKEAIRKALENAVDVGLSVQCSEAELTELF 119 +LE +G ++T QG GTFV+ + E + + K EA+ L+ AV+VG ++ EL ++ Sbjct: 61 NLEQQGYIKTSQGRGTFVAEIDERSKKEAKTEAVYDTLKKAVEVGRRHSYTDDELRKII 119 >ref|NP_242030.1| transcriptional regulator (GntR family) [Bacillus halodurans] pir||D83795 transcription regulator (GntR family) BH1164 [imported] - Bacillus halodurans (strain C-125) dbj|BAB04883.1| transcriptional regulator (GntR family) [Bacillus halodurans] Length = 135 Score = 113 bits (282), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 56/126 (44%), Positives = 79/126 (62%) Query: 1 MWIPIQINENSAEPLYHQIETQLKSLIISGVITEGTLLPSIREFAGDLKCSVITVRRVYQ 60 M +PI+I +NS P+YHQIE Q+K+LI+SG + EG LPSIR A + CSVIT RR YQ Sbjct: 1 MKLPIKIEQNSRSPIYHQIEEQIKALIVSGHLNEGDPLPSIRALAKETACSVITTRRAYQ 60 Query: 61 DLENEGLLRTRQGTGTFVSHVGEGAMEGYKKEAIRKALENAVDVGLSVQCSEAELTELFT 120 +LE EG +RT QG GTFV+ +G+ E K + L A++ G S +L ++ Sbjct: 61 NLEQEGYIRTTQGKGTFVAKIGDEIKEQTKFSTVYHTLSMAIETGRRHDYSFEQLLDMVH 120 Query: 121 EIVKHK 126 I++ + Sbjct: 121 TIIQQQ 126 >ref|NP_781465.1| transcriptional regulator, gntR family [Clostridium tetani E88] gb|AAO35402.1| transcriptional regulator, gntR family [Clostridium tetani E88] Length = 121 Score = 82.0 bits (201), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 44/109 (40%), Positives = 65/109 (59%), Gaps = 4/109 (3%) Query: 5 IQINENSAEPLYHQIETQLKSLIISGVITEGTLLPSIREFAGDLKCSVITVRRVYQDLEN 64 I I+ +S EP+Y QI TQ+K+LI+S + EG +LPSIR A +L SVIT +R Y +LE Sbjct: 3 IIISNSSKEPIYEQIATQIKNLILSNKLKEGEILPSIRNLAKELSISVITTKRAYDELEK 62 Query: 65 EGLLRTRQGTGTFVSHVGEGAMEGYKKEAIRKALENAVD----VGLSVQ 109 EG + T G G+FV+ + + + I K L ++ + LS+Q Sbjct: 63 EGFIETTPGRGSFVASQNKELLRERRLSIIEKKLTEVINDCKLMNLSLQ 111 >ref|NP_656917.1| HTH_GNTR, helix_turn_helix gluconate operon transcriptional repressor [Bacillus anthracis A2012] ref|NP_845379.1| transcriptional regulator, GntR family [Bacillus anthracis str. Ames] gb|AAP26865.1| transcriptional regulator, GntR family [Bacillus anthracis str. Ames] Length = 129 Score = 82.0 bits (201), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 42/118 (35%), Positives = 67/118 (56%) Query: 3 IPIQINENSAEPLYHQIETQLKSLIISGVITEGTLLPSIREFAGDLKCSVITVRRVYQDL 62 + I I S EP+Y QI Q+K LI+ G + +G LPS+R+ A DL+ S+IT +R Y++L Sbjct: 1 MQITITNTSKEPIYEQISAQIKKLILLGDLKQGDALPSMRQLAKDLRVSIITTKRAYEEL 60 Query: 63 ENEGLLRTRQGTGTFVSHVGEGAMEGYKKEAIRKALENAVDVGLSVQCSEAELTELFT 120 E +G + + G G+FV+ M+ K + + + L A+ + S EL E+ T Sbjct: 61 EKDGFINSIVGRGSFVAEQNIETMKEEKLKTVEEKLCEAIQNAKQMDVSLNELKEMLT 118 >ref|ZP_00120508.1| COG1725: Predicted transcriptional regulators [Bifidobacterium longum DJO10A] Length = 124 Score = 81.6 bits (200), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 41/95 (43%), Positives = 62/95 (65%) Query: 7 INENSAEPLYHQIETQLKSLIISGVITEGTLLPSIREFAGDLKCSVITVRRVYQDLENEG 66 I+ S EP+Y QI+TQ++S ++SG + G LPS+R+ A +L+ SV+TV R Y +L +EG Sbjct: 5 ISSVSGEPIYEQIKTQIRSAVLSGELKAGEALPSLRKLAKELRISVLTVTRAYNELADEG 64 Query: 67 LLRTRQGTGTFVSHVGEGAMEGYKKEAIRKALENA 101 +++ QG GTFV G M+ K IR++L A Sbjct: 65 VVQNIQGKGTFVMDKGNELMQRQLKTQIRESLAEA 99 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.316 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 182,189,669 Number of extensions: 6797607 Number of successful extensions: 18186 Number of sequences better than 1.0e-05: 140 Number of HSP's gapped: 18208 Number of HSP's successfully gapped: 140 Length of query: 131 Length of database: 757,237,578 Length adjustment: 94 Effective length of query: 37 Effective length of database: 502,018,272 Effective search space: 18574676064 Effective search space used: 18574676064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)