BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0225.0002.p
         (58 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF 
           2,715,099 sequences; 757,237,578 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_068946.1| conserved hypothetical protein [Archaeoglobus f...    54   8e-07

>ref|NP_068946.1| conserved hypothetical protein [Archaeoglobus fulgidus DSM 4304]
 sp|O30131|Y105_ARCFU Hypothetical protein AF0105
 pir||A69263 conserved hypothetical protein AF0105 - Archaeoglobus fulgidus
 gb|AAB91127.1| conserved hypothetical protein [Archaeoglobus fulgidus DSM 4304]
          Length = 103

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%)

Query: 2   VAHVLCGFIPLLGPLAAPIISLCSFAVWLLMIYHALGGRWYRLPWAGDIAERQL 55
           V  +   FIP +G L  PI+ L +F  WL+ IY A    W++LP  GDIAE+Q+
Sbjct: 47  VLDIALSFIPYIGVLLIPIVGLVAFITWLVCIYKAYSNEWFKLPVVGDIAEQQI 100


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 24, 2004  1:53 AM
  Number of letters in database: 757,237,578
  Number of sequences in database:  2,715,099
  
Lambda     K      H
   0.334    0.148    0.528 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 2715099
Number of Hits to DB: 89,300,876
Number of extensions: 2583577
Number of successful extensions: 9431
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 9431
Number of HSP's successfully gapped: 1
Length of query: 58
Length of database: 757,237,578
Length adjustment: 30
Effective length of query: 28
Effective length of database: 675,784,608
Effective search space: 18921969024
Effective search space used: 18921969024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 120 (50.8 bits)