BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0214.0002.p (86 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_633476.1| Universal stress protein [Methanosarcina mazei ... 71 8e-12 ref|ZP_00188095.1| hypothetical protein Rxyl073901 [Rubrobacter ... 71 1e-11 ref|ZP_00076749.1| COG0589: Universal stress protein UspA and re... 69 3e-11 ref|NP_391804.1| similar to hypothetical proteins [Bacillus subt... 67 9e-11 ref|NP_377486.1| 157aa long conserved hypothetical protein [Sulf... 67 1e-10 >ref|NP_633476.1| Universal stress protein [Methanosarcina mazei Goe1] gb|AAM31148.1| Universal stress protein [Methanosarcina mazei Goe1] Length = 323 Score = 70.9 bits (172), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 36/76 (47%), Positives = 53/76 (69%) Query: 11 QTTDEVKSRLEAEGLNATVELLQGSPAEVILTYAKEQGADVIVIGSRGLGGIREFVLGSV 70 + T V+ + A G+ +L+G+PAE I+ +A+EQ D+IV+GS G GI+ F+LGSV Sbjct: 74 KATSYVEKKATAAGMKVESIVLKGNPAEEIVDFAEEQRVDMIVVGSLGKSGIKRFMLGSV 133 Query: 71 SHNVVQSARIPVLVVK 86 S VV+ A+IPVLVV+ Sbjct: 134 SEKVVRRAKIPVLVVR 149 Score = 63.9 bits (154), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 30/70 (42%), Positives = 49/70 (70%) Query: 16 VKSRLEAEGLNATVELLQGSPAEVILTYAKEQGADVIVIGSRGLGGIREFVLGSVSHNVV 75 V+ + A G+ +L+G+PAE I+ +A+EQ D+IV+GS G G +F +GSVS V+ Sbjct: 225 VEEKANAAGVKVESAVLEGNPAEEIVDFAEEQKVDMIVVGSLGKSGYEQFAIGSVSSKVL 284 Query: 76 QSARIPVLVV 85 ++A++PVL+V Sbjct: 285 RNAKVPVLIV 294 >ref|ZP_00188095.1| hypothetical protein Rxyl073901 [Rubrobacter xylanophilus DSM 9941] Length = 151 Score = 70.9 bits (172), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 38/73 (52%), Positives = 54/73 (73%) Query: 14 DEVKSRLEAEGLNATVELLQGSPAEVILTYAKEQGADVIVIGSRGLGGIREFVLGSVSHN 73 +EV+S E+ G A +L G+PAE I++ A+E GA +IV+GSRGLGG+R ++GSVS + Sbjct: 67 EEVRSIEESGGAVAEGHVLLGNPAESIVSLAEEMGAGLIVVGSRGLGGLRRALMGSVSES 126 Query: 74 VVQSARIPVLVVK 86 VV+ A PVLVV+ Sbjct: 127 VVRHAHCPVLVVR 139 >ref|ZP_00076749.1| COG0589: Universal stress protein UspA and related nucleotide-binding proteins [Methanosarcina barkeri] Length = 157 Score = 69.3 bits (168), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 31/76 (40%), Positives = 54/76 (71%) Query: 11 QTTDEVKSRLEAEGLNATVELLQGSPAEVILTYAKEQGADVIVIGSRGLGGIREFVLGSV 70 + D VKS E +G+N LL+GSP+E ++ YA+E+ D++V+G+ G G+ +LGSV Sbjct: 77 EAVDSVKSLGETKGINVETVLLEGSPSEELIRYAEEEKMDIVVMGTLGKTGLNRLLLGSV 136 Query: 71 SHNVVQSARIPVLVVK 86 + N+V+ +++PV+VV+ Sbjct: 137 AENLVRHSKVPVMVVR 152 >ref|NP_391804.1| similar to hypothetical proteins [Bacillus subtilis] sp|P42297|YXIE_BACSU Hypothetical protein yxiE precursor pir||A70077 conserved hypothetical protein yxiE N17E [imported] - Bacillus subtilis dbj|BAA06654.1| hypothetical protein [Bacillus subtilis] dbj|BAA06258.1| hypothetical 15.9-kDa protein [Bacillus subtilis] emb|CAB15961.1| yxiE [Bacillus subtilis subsp. subtilis str. 168] Length = 148 Score = 67.4 bits (163), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 32/73 (43%), Positives = 47/73 (64%) Query: 14 DEVKSRLEAEGLNATVELLQGSPAEVILTYAKEQGADVIVIGSRGLGGIREFVLGSVSHN 73 + K + +G+ A G PA IL +AKE+G +IV+GSRG+ G++E +LGSVSH Sbjct: 76 ENAKEKAAEKGVQAETIYANGEPAHEILNHAKEKGVSLIVVGSRGISGLKEMMLGSVSHK 135 Query: 74 VVQSARIPVLVVK 86 V Q + PVL+V+ Sbjct: 136 VSQLSTCPVLIVR 148 >ref|NP_377486.1| 157aa long conserved hypothetical protein [Sulfolobus tokodaii] dbj|BAB66595.1| 157aa long conserved hypothetical protein [Sulfolobus tokodaii] Length = 157 Score = 67.0 bits (162), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 38/83 (45%), Positives = 53/83 (63%), Gaps = 3/83 (3%) Query: 6 YDLAVQTTDEVKSRLEAEGLNATVE--LLQGSPAEVILTYAKEQGADVIVIGSRGLGGIR 63 Y+ A + K++ + +G+ VE +L+G PA IL YA + G D+IV GSRGL + Sbjct: 76 YNKAKSDINNAKAKAQNQGVK-DVEGVVLEGDPATAILEYAGKNGVDLIVTGSRGLSTFK 134 Query: 64 EFVLGSVSHNVVQSARIPVLVVK 86 +LGSVS +VQ A+IPVLVVK Sbjct: 135 RIILGSVSTKLVQEAKIPVLVVK 157 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.314 0.134 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 113,355,671 Number of extensions: 3834792 Number of successful extensions: 11397 Number of sequences better than 1.0e-05: 110 Number of HSP's gapped: 11451 Number of HSP's successfully gapped: 112 Length of query: 86 Length of database: 757,237,578 Length adjustment: 55 Effective length of query: 31 Effective length of database: 607,907,133 Effective search space: 18845121123 Effective search space used: 18845121123 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 120 (50.8 bits)