BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0212.0013.p (141 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_833787.1| Stage V sporulation protein AB [Bacillus cereus... 74 1e-12 ref|NP_658109.1| hypothetical protein predicted by GeneMark [Bac... 74 2e-12 ref|NP_390224.1| mutants lead to the production of immature spor... 68 7e-11 ref|NP_692756.1| stage V sporulation protein AB [Oceanobacillus ... 66 3e-10 ref|NP_980431.1| stage V sporulation protein AB [Bacillus cereus... 65 4e-10 >ref|NP_833787.1| Stage V sporulation protein AB [Bacillus cereus ATCC 14579] gb|AAP10988.1| Stage V sporulation protein AB [Bacillus cereus ATCC 14579] Length = 140 Score = 73.6 bits (179), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 43/109 (39%), Positives = 58/109 (53%) Query: 33 DMVPRLAQLTSSYDKVHWYEGAMVGGSLLGTMSDFWNWRISAGPXXXXXXXXXXXXXXXX 92 ++PRLAQLT S + ++E A++ G+L G N Sbjct: 32 GIIPRLAQLTRSGKHIQYFEWAVIAGTLTGAWCSLKNITFQTSQYWLVILGIFCGTFIGM 91 Query: 93 XAAALTEVLNVLPILAKRLRMTHLLFGLLMAMVCGKVAGSLFDWFVYQQ 141 AAALTEVLNVLPILAKR+ + + LL+A+V GKV GSLF W + + Sbjct: 92 LAAALTEVLNVLPILAKRVGVEGKIIVLLVALVLGKVIGSLFHWIYFVK 140 >ref|NP_658109.1| hypothetical protein predicted by GeneMark [Bacillus anthracis A2012] ref|NP_846523.1| stage V sporulation protein AB [Bacillus anthracis str. Ames] gb|AAP28009.1| stage V sporulation protein AB [Bacillus anthracis str. Ames] Length = 138 Score = 73.6 bits (179), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 43/109 (39%), Positives = 58/109 (53%) Query: 33 DMVPRLAQLTSSYDKVHWYEGAMVGGSLLGTMSDFWNWRISAGPXXXXXXXXXXXXXXXX 92 ++PRLAQLT S + ++E A++ G+L G N Sbjct: 30 GIIPRLAQLTRSGKHIQYFEWAVIAGTLTGAWCSLKNITFQTSQYWLVILGIFCGTFIGM 89 Query: 93 XAAALTEVLNVLPILAKRLRMTHLLFGLLMAMVCGKVAGSLFDWFVYQQ 141 AAALTEVLNVLPILAKR+ + + LL+A+V GKV GSLF W + + Sbjct: 90 LAAALTEVLNVLPILAKRVGVEGKIVVLLIALVLGKVIGSLFHWIYFVK 138 >ref|NP_390224.1| mutants lead to the production of immature spores (stage V sporulation) [Bacillus subtilis] sp|P40867|SP52_BACSU Stage V sporulation protein AB pir||E69714 spore formation protein spoVAB - Bacillus subtilis dbj|BAA12657.1| SpoVAB [Bacillus subtilis] emb|CAB14275.1| spoVAB [Bacillus subtilis subsp. subtilis str. 168] Length = 141 Score = 67.8 bits (164), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 45/112 (40%), Positives = 61/112 (54%), Gaps = 10/112 (8%) Query: 33 DMVPRLAQLTSSYDKVHWYEGAMVGGSLLGT-----MSDFWNWRISAGPXXXXXXXXXXX 87 ++PRL QLT + V YE A++ G++ G M+ + + A P Sbjct: 31 GIIPRLMQLTKTMRFVQAYEAAVILGAVCGGWETLHMNHLYLTKWIAVPVGLLAGLFVGM 90 Query: 88 XXXXXXAAALTEVLNVLPILAKRLRMTHLLFGLLMAMVCGKVAGSLFDWFVY 139 AAALTEVLNVLPILAKR+ + + LLMA+V GK+AGSLF W + Sbjct: 91 L-----AAALTEVLNVLPILAKRIGLRSKIIILLMAIVIGKIAGSLFHWLYF 137 >ref|NP_692756.1| stage V sporulation protein AB [Oceanobacillus iheyensis HTE831] dbj|BAC13791.1| stage V sporulation protein AB [Oceanobacillus iheyensis HTE831] Length = 142 Score = 65.9 bits (159), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 38/107 (35%), Positives = 56/107 (52%) Query: 33 DMVPRLAQLTSSYDKVHWYEGAMVGGSLLGTMSDFWNWRISAGPXXXXXXXXXXXXXXXX 92 ++PRL QL+ S Y GA++ G L+GT F ++ Sbjct: 34 GIIPRLVQLSKSEAFTKAYGGAVIFGLLIGTYFSFAPITLNQTTIIVIFWGLLHGIFNGM 93 Query: 93 XAAALTEVLNVLPILAKRLRMTHLLFGLLMAMVCGKVAGSLFDWFVY 139 AAALTEV+NV PIL++R+ M + +MA++ GKV GSLF W ++ Sbjct: 94 LAAALTEVVNVFPILSRRIGMDAFVLIFMMALLLGKVFGSLFQWTIF 140 >ref|NP_980431.1| stage V sporulation protein AB [Bacillus cereus ATCC 10987] gb|AAS43039.1| stage V sporulation protein AB [Bacillus cereus ATCC 10987] Length = 138 Score = 65.1 bits (157), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 43/109 (39%), Positives = 58/109 (53%) Query: 33 DMVPRLAQLTSSYDKVHWYEGAMVGGSLLGTMSDFWNWRISAGPXXXXXXXXXXXXXXXX 92 ++PRLAQLT S + ++E A++ G+L G N Sbjct: 30 GIIPRLAQLTRSGKHIQYFEWAVIAGTLTGAWCSLKNITFQTSQYWLVILGIFCGTFIGM 89 Query: 93 XAAALTEVLNVLPILAKRLRMTHLLFGLLMAMVCGKVAGSLFDWFVYQQ 141 AAALTEVLNVLPILAKR+ + + LL+A+V GKV GSLF W + + Sbjct: 90 LAAALTEVLNVLPILAKRVGVEGKIVVLLVALVLGKVIGSLFHWIYFVK 138 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.326 0.136 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 124,750,579 Number of extensions: 3144139 Number of successful extensions: 11432 Number of sequences better than 1.0e-05: 5 Number of HSP's gapped: 11427 Number of HSP's successfully gapped: 5 Length of query: 141 Length of database: 757,237,578 Length adjustment: 102 Effective length of query: 39 Effective length of database: 480,297,480 Effective search space: 18731601720 Effective search space used: 18731601720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 120 (50.8 bits)