BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0207.0004.p (122 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_00098000.1| COG1937: Uncharacterized protein conserved in... 96 2e-19 ref|NP_372611.1| conserved hypothetical protein [Staphylococcus ... 89 3e-17 ref|NP_765241.1| conserved hypothetical protein [Staphylococcus ... 87 9e-17 ref|NP_710773.1| conserved hypothetical protein [Leptospira inte... 67 9e-11 ref|NP_903312.1| conserved hypothetical protein [Chromobacterium... 65 6e-10 >ref|ZP_00098000.1| COG1937: Uncharacterized protein conserved in bacteria [Desulfitobacterium hafniense] Length = 111 Score = 96.3 bits (238), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 48/101 (47%), Positives = 63/101 (62%), Gaps = 2/101 (1%) Query: 24 CH--TSAPGVRKSHHSAEFKSGLTTRLNRIEGQIRGVKGMIERDTYCDDXXXXXXXXXXX 81 CH S R SHH+ + L R+NRIEGQIRG+KGMIE YCDD Sbjct: 11 CHDSNSQKSERLSHHNEKTIRELANRMNRIEGQIRGIKGMIENHAYCDDVLNQIASAQAA 70 Query: 82 XXSVGKLLLEGHMKSCIIERIEAGEHEVIDELLVTVNKLMK 122 V KLLLE HMKSC++E+++ G +VIDEL+ T++++MK Sbjct: 71 LNGVSKLLLEKHMKSCVLEQLQEGNEQVIDELVKTMHRMMK 111 >ref|NP_372611.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_375195.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] ref|NP_646827.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] pir||E90001 conserved hypothetical protein SA1890 [imported] - Staphylococcus aureus (strain N315) dbj|BAB43174.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB58249.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB95875.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 97 Score = 89.4 bits (220), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 43/90 (47%), Positives = 56/90 (62%), Gaps = 1/90 (1%) Query: 34 SHHSAEFKSGLTTRLNRIEGQIRGVKGMIERDTYCDDXXXXXXXXXXXXXSVGKLLLEGH 93 +HHS + K+ L +RLNRIEGQ+R + MIE D YCDD SV LLE H Sbjct: 7 AHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVLTQIRATRSALNSVAIKLLEQH 66 Query: 94 MKSCIIERIEAG-EHEVIDELLVTVNKLMK 122 MKSCI+ ++ G + E ++ELLVT KL+K Sbjct: 67 MKSCIMNKVNQGAQEEAMEELLVTFQKLIK 96 >ref|NP_765241.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] gb|AAO05285.1| conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] Length = 97 Score = 87.4 bits (215), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 43/90 (47%), Positives = 56/90 (62%), Gaps = 1/90 (1%) Query: 34 SHHSAEFKSGLTTRLNRIEGQIRGVKGMIERDTYCDDXXXXXXXXXXXXXSVGKLLLEGH 93 +HHS + K+ L +RLNRIEGQ+R + MI+ D YCDD SV LL+ H Sbjct: 7 AHHSEQIKTNLKSRLNRIEGQVRAINRMIDDDVYCDDVLTQIRATRSALNSVATKLLDHH 66 Query: 94 MKSCIIERIEAG-EHEVIDELLVTVNKLMK 122 MK CI+E+I G + E +DELLVT KL+K Sbjct: 67 MKGCIMEKINDGAQEEAMDELLVTFQKLIK 96 >ref|NP_710773.1| conserved hypothetical protein [Leptospira interrogans serovar lai str. 56601] gb|AAN47791.1| conserved hypothetical protein [Leptospira interrogans serovar lai str. 56601] gb|AAS71534.1| conserved hypothetical protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] Length = 97 Score = 67.4 bits (163), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 29/79 (36%), Positives = 48/79 (60%) Query: 44 LTTRLNRIEGQIRGVKGMIERDTYCDDXXXXXXXXXXXXXSVGKLLLEGHMKSCIIERIE 103 L RL +IEGQIRG++GMIE + YCDD V + LL+ H+++C+ ERI Sbjct: 19 LILRLKKIEGQIRGIQGMIENEKYCDDVLNQISSVKSALDGVSRGLLKSHIRTCVTERIR 78 Query: 104 AGEHEVIDELLVTVNKLMK 122 + ++++E + TV +++ Sbjct: 79 GNDSKILEEFMTTVGYILR 97 >ref|NP_903312.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] gb|AAQ61304.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 107 Score = 64.7 bits (156), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 38/107 (35%), Positives = 52/107 (48%), Gaps = 6/107 (5%) Query: 15 HAGHSCGDDCHTSAPGVRKSHHSAEFKSGLTTRLNRIEGQIRGVKGMIERDTYCDDXXXX 74 H+ +C CH A R K+ L RL RIEGQ+RG+ GMIE D YC D Sbjct: 5 HSSQAC---CHEEAQAERSVVQPG--KAALLKRLARIEGQVRGISGMIESDRYCVDVLTQ 59 Query: 75 XXXXXXXXXSVGKLLLEGHMKSCIIERIEAGEHE-VIDELLVTVNKL 120 +V LLE HMK C+ ++ G+ ++ EL+ V K+ Sbjct: 60 VAAVKSALDAVALQLLENHMKGCVARALQQGDATGMVTELIDVVKKV 106 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.318 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 151,869,929 Number of extensions: 4452975 Number of successful extensions: 7800 Number of sequences better than 1.0e-05: 26 Number of HSP's gapped: 7807 Number of HSP's successfully gapped: 26 Length of query: 122 Length of database: 757,237,578 Length adjustment: 86 Effective length of query: 36 Effective length of database: 523,739,064 Effective search space: 18854606304 Effective search space used: 18854606304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)