BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0207.0001.p (103 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_243071.1| dihydrolipoamide succinyltransferase [Bacillus ... 83 2e-15 ref|NP_389818.1| 2-oxoglutarate dehydrogenase complex (dihydroli... 82 4e-15 ref|NP_692011.1| 2-oxoglutarate dehydrogenase E2 subunit [Oceano... 80 2e-14 ref|NP_977700.1| 2-oxoglutarate dehydrogenase, E2 component, dih... 75 4e-13 ref|NP_831035.1| Dihydrolipoamide succinyltransferase component ... 75 4e-13 >ref|NP_243071.1| dihydrolipoamide succinyltransferase [Bacillus halodurans] pir||E83925 dihydrolipoamide succinyltransferase BH2205 [imported] - Bacillus halodurans (strain C-125) dbj|BAB05924.1| dihydrolipoamide succinyltransferase [Bacillus halodurans] Length = 411 Score = 83.2 bits (204), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 42/66 (63%), Positives = 51/66 (77%) Query: 3 EIKVPDLGESISEGTIYKWLVKEGDTVGQGDVLAELETDKVNLEISAEEDGVISSLLRQA 62 EIKVP+L ESI+EGTI +WL K GD V QG+ +AELETDKVN+EI+AE GVI L R+ Sbjct: 3 EIKVPELAESITEGTIAQWLKKVGDHVSQGEYIAELETDKVNVEITAEHSGVIQELKREE 62 Query: 63 GENVAV 68 G+ V V Sbjct: 63 GDTVEV 68 >ref|NP_389818.1| 2-oxoglutarate dehydrogenase complex (dihydrolipoamide transsuccinylase, E2 subunit) [Bacillus subtilis] sp|P16263|ODO2_BACSU Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) pir||B32879 dihydrolipoamide S-succinyltransferase (EC 2.3.1.61) odhB - Bacillus subtilis gb|AAA22629.1| dihydrolipoamide transsuccinylase (odhB; EC 2.3.1.61) emb|CAB13828.1| 2-oxoglutarate dehydrogenase complex (dihydrolipoamide transsuccinylase, E2 subunit) [Bacillus subtilis subsp. subtilis str. 168] Length = 417 Score = 82.0 bits (201), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 40/68 (58%), Positives = 54/68 (79%) Query: 1 VSEIKVPDLGESISEGTIYKWLVKEGDTVGQGDVLAELETDKVNLEISAEEDGVISSLLR 60 ++EIKVP+L ESISEGTI +WL + GD V QG+ L ELETDKVN+E++AEE GV+ +L+ Sbjct: 1 MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLQEVLK 60 Query: 61 QAGENVAV 68 +G+ V V Sbjct: 61 DSGDTVQV 68 >ref|NP_692011.1| 2-oxoglutarate dehydrogenase E2 subunit [Oceanobacillus iheyensis HTE831] dbj|BAC13046.1| 2-oxoglutarate dehydrogenase E2 subunit (dihydrolipoamide S-succinyltransferase) [Oceanobacillus iheyensis HTE831] Length = 422 Score = 79.7 bits (195), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 38/68 (55%), Positives = 55/68 (80%) Query: 1 VSEIKVPDLGESISEGTIYKWLVKEGDTVGQGDVLAELETDKVNLEISAEEDGVISSLLR 60 + EIK+P+L ESI+EGTI +WLVK+GD V +GD + ELETDKVN+E++AE GVI+ ++ Sbjct: 1 MQEIKIPELAESITEGTIAEWLVKKGDKVEKGDPVVELETDKVNVEVNAEFSGVITEIIS 60 Query: 61 QAGENVAV 68 + G++V V Sbjct: 61 EEGDDVTV 68 >ref|NP_977700.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase [Bacillus cereus ATCC 10987] gb|AAS40308.1| 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase [Bacillus cereus ATCC 10987] Length = 424 Score = 75.5 bits (184), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 38/66 (57%), Positives = 50/66 (75%) Query: 3 EIKVPDLGESISEGTIYKWLVKEGDTVGQGDVLAELETDKVNLEISAEEDGVISSLLRQA 62 EIKVP+L ESI+EGTI +WL+ GD V +G + ELETDKVN+EI AE+ G++S LL + Sbjct: 3 EIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLGEP 62 Query: 63 GENVAV 68 G+ V V Sbjct: 63 GDTVEV 68 >ref|NP_831035.1| Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex [Bacillus cereus ATCC 14579] gb|AAP08236.1| Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex [Bacillus cereus ATCC 14579] Length = 419 Score = 75.5 bits (184), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 38/66 (57%), Positives = 50/66 (75%) Query: 3 EIKVPDLGESISEGTIYKWLVKEGDTVGQGDVLAELETDKVNLEISAEEDGVISSLLRQA 62 EIKVP+L ESI+EGTI +WL+ GD V +G + ELETDKVN+EI AE+ G++S LL + Sbjct: 3 EIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLGEP 62 Query: 63 GENVAV 68 G+ V V Sbjct: 63 GDTVEV 68 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.307 0.132 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 95,197,009 Number of extensions: 3031928 Number of successful extensions: 10677 Number of sequences better than 1.0e-05: 833 Number of HSP's gapped: 10837 Number of HSP's successfully gapped: 866 Length of query: 103 Length of database: 757,237,578 Length adjustment: 70 Effective length of query: 33 Effective length of database: 567,180,648 Effective search space: 18716961384 Effective search space used: 18716961384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (22.0 bits) S2: 120 (50.8 bits)