BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0197.0012.p (147 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_464509.1| weakly similar to two-component response regula... 105 4e-22 ref|NP_470320.1| weakly similar to two-component response regula... 102 2e-21 ref|NP_720752.1| conserved hypothetical protein [Streptococcus m... 86 3e-16 ref|NP_721462.1| conserved hypothetical protein [Streptococcus m... 62 5e-09 ref|NP_816798.1| response regulator [Enterococcus faecalis V583]... 60 1e-08 >ref|NP_464509.1| weakly similar to two-component response regulator [Listeria monocytogenes EGD-e] pir||AH1197 two-component response regulator homolog lmo0984 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAC99062.1| lmo0984 [Listeria monocytogenes] Length = 151 Score = 105 bits (261), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 54/127 (42%), Positives = 80/127 (62%), Gaps = 4/127 (3%) Query: 23 PD--EAVLKLLYSIQAMAASRKLIGMTDLQMHIIDPDEVYYFEAVDHKVFIYCAEKVYES 80 PD E V ++ I + K+ D ++++P + YFEAV+ K+F+Y +++YE Sbjct: 22 PDNLEEVTNIVMGIDE--PTEKISVKKDGATYLLEPKAILYFEAVESKIFVYTEKEIYEI 79 Query: 81 RLKLYEIEQAYAHRDFFRASKSTVLNIAKIKSVSPLLYGRFEALLHNGEKVIISRQYVPV 140 KLYE+E+ + FFR SKS +LNI I+ ++P +G+FEA L N EKVIISRQY V Sbjct: 80 HWKLYELEEKFKDSSFFRCSKSMILNIEWIEKIAPGFHGKFEAKLFNREKVIISRQYAKV 139 Query: 141 LRQKLGL 147 L+QKL + Sbjct: 140 LKQKLNM 146 >ref|NP_470320.1| weakly similar to two-component response regulator [Listeria innocua] pir||AF1555 weakly two-component response regulator homolog lin0983 [imported] - Listeria innocua (strain Clip11262) emb|CAC96214.1| lin0983 [Listeria innocua] Length = 151 Score = 102 bits (255), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 52/123 (42%), Positives = 79/123 (64%), Gaps = 2/123 (1%) Query: 25 EAVLKLLYSIQAMAASRKLIGMTDLQMHIIDPDEVYYFEAVDHKVFIYCAEKVYESRLKL 84 E V K++ ++ + K+ D +++ ++ YFEAV+ K+F+Y + VYE+ KL Sbjct: 26 EEVTKIVMGLEEQ--TEKISVKKDGVTYLLAKRKILYFEAVESKIFVYTEKDVYETTWKL 83 Query: 85 YEIEQAYAHRDFFRASKSTVLNIAKIKSVSPLLYGRFEALLHNGEKVIISRQYVPVLRQK 144 YE+E+ + FFR SKS +LNI I+ ++P +G+FEA L N EKVIISRQY +L+QK Sbjct: 84 YELEEKFKDSSFFRCSKSMILNIEWIEKIAPGFHGKFEASLFNREKVIISRQYAKILKQK 143 Query: 145 LGL 147 L L Sbjct: 144 LNL 146 >ref|NP_720752.1| conserved hypothetical protein [Streptococcus mutans UA159] gb|AAN58058.1| conserved hypothetical protein [Streptococcus mutans UA159] Length = 161 Score = 85.9 bits (211), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 38/108 (35%), Positives = 71/108 (65%) Query: 38 AASRKLIGMTDLQMHIIDPDEVYYFEAVDHKVFIYCAEKVYESRLKLYEIEQAYAHRDFF 97 R+L + + ++++ ++YY E+VD K F+Y A+++Y++ L+LY++ H F Sbjct: 50 TVDRQLSCYQEGRKYLVNFSDIYYIESVDKKTFVYLADEIYQTDLRLYQLLHDLQHDGFV 109 Query: 98 RASKSTVLNIAKIKSVSPLLYGRFEALLHNGEKVIISRQYVPVLRQKL 145 + SKS +LNI ++++ PL R EA L NGE+VI++R+Y+P +++ L Sbjct: 110 QISKSCLLNINVLENIRPLFNSRMEATLLNGERVIVNRRYLPDVKEAL 157 >ref|NP_721462.1| conserved hypothetical protein [Streptococcus mutans UA159] gb|AAN58768.1| conserved hypothetical protein [Streptococcus mutans UA159] Length = 175 Score = 61.6 bits (148), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 34/86 (39%), Positives = 49/86 (56%) Query: 57 DEVYYFEAVDHKVFIYCAEKVYESRLKLYEIEQAYAHRDFFRASKSTVLNIAKIKSVSPL 116 D++ Y E VD VF Y KVY+ L ++E +Y + R SKS ++NI KI + Sbjct: 79 DDILYCERVDGLVFAYTKNKVYQIFHSLRDLEASYYRLGYVRCSKSMIVNIYKIHYFNSE 138 Query: 117 LYGRFEALLHNGEKVIISRQYVPVLR 142 YGR A + N E++IISR+Y +R Sbjct: 139 PYGRIRATMENKEEIIISRKYANRIR 164 >ref|NP_816798.1| response regulator [Enterococcus faecalis V583] sp|Q82Z76|LYTT_ENTFA Sensory transduction protein lytT gb|AAO82868.1| response regulator [Enterococcus faecalis V583] Length = 242 Score = 60.5 bits (145), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 29/98 (29%), Positives = 54/98 (55%) Query: 50 QMHIIDPDEVYYFEAVDHKVFIYCAEKVYESRLKLYEIEQAYAHRDFFRASKSTVLNIAK 109 +++++ P+++Y + ++ I+ ++VY+ L IEQ F + +S +LN K Sbjct: 144 RIYLVAPEDIYLVSVEERQLSIFVDQQVYKMTGTLNSIEQKLPATLFIKTHRSFILNRTK 203 Query: 110 IKSVSPLLYGRFEALLHNGEKVIISRQYVPVLRQKLGL 147 I+ + P + +L NG KV +SR YV ++KLGL Sbjct: 204 IQEIQPWFNNTLQVILTNGSKVPVSRSYVKEFKEKLGL 241 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.325 0.139 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 176,169,825 Number of extensions: 6115917 Number of successful extensions: 23328 Number of sequences better than 1.0e-05: 17 Number of HSP's gapped: 23342 Number of HSP's successfully gapped: 17 Length of query: 147 Length of database: 757,237,578 Length adjustment: 107 Effective length of query: 40 Effective length of database: 466,721,985 Effective search space: 18668879400 Effective search space used: 18668879400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 120 (50.8 bits)