BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0188.0075.p (83 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_387990.1| alternate gene name: ybaB~similar to ribosomal ... 78 7e-14 sp|Q9EV99|RXL7_BACST Putative ribosomal protein L7Ae-like >gi|10... 74 2e-12 ref|ZP_00180179.1| hypothetical protein Mther186401 [Moorella th... 71 9e-12 ref|NP_623837.1| Ribosomal protein HS6-type (S12/L30/L7a) [Therm... 69 3e-11 ref|NP_240994.1| ribosomal protein L7AE family [Bacillus halodur... 66 3e-10 >ref|NP_387990.1| alternate gene name: ybaB~similar to ribosomal protein L7AE family [Bacillus subtilis] sp|P46350|RXL7_BACSU Putative ribosomal protein L7Ae-like pir||G69751 ribosomal protein L7AE family homolog ybxF - Bacillus subtilis gb|AAB59113.1| orf 82; similar to orf102 of Sulfolobus acidocaldarius dbj|BAA11000.1| unknown [Bacillus subtilis] emb|CAB11885.1| ybxF [Bacillus subtilis subsp. subtilis str. 168] Length = 82 Score = 77.8 bits (190), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 41/81 (50%), Positives = 54/81 (66%) Query: 1 MTDDMGLQDAQVKIGTKQTVKAVELGQAAEVYVAEDGDQRLTSRIVMLCNKQGVKITYVD 60 M+ D Q + IGTKQTVKA++ G EV VA+D D LTS +V L QG+ ++ V+ Sbjct: 1 MSYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVE 60 Query: 61 TMLNLGKACGIEVGAAMAAVL 81 +M LGKACGIEVGAA A++ Sbjct: 61 SMKKLGKACGIEVGAAAVAII 81 >sp|Q9EV99|RXL7_BACST Putative ribosomal protein L7Ae-like emb|CAC09926.1| ybxF protein [Geobacillus stearothermophilus] Length = 82 Score = 73.6 bits (179), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 37/82 (45%), Positives = 55/82 (67%) Query: 1 MTDDMGLQDAQVKIGTKQTVKAVELGQAAEVYVAEDGDQRLTSRIVMLCNKQGVKITYVD 60 M+ + LQ ++ IGTKQT++A++ G+A EV VAED D + ++ N+ V +T VD Sbjct: 1 MSYEKVLQAGKIVIGTKQTIRALKEGEATEVIVAEDADLPIIEKVTAAANEANVPVTKVD 60 Query: 61 TMLNLGKACGIEVGAAMAAVLK 82 +M LGKAC I+VGAA A+L+ Sbjct: 61 SMKKLGKACKIQVGAAAVAILR 82 >ref|ZP_00180179.1| hypothetical protein Mther186401 [Moorella thermoacetica ATCC 39073] Length = 83 Score = 70.9 bits (172), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 31/70 (44%), Positives = 49/70 (70%) Query: 14 IGTKQTVKAVELGQAAEVYVAEDGDQRLTSRIVMLCNKQGVKITYVDTMLNLGKACGIEV 73 +GTKQ KAV G+A V++A D + +T + LC ++G+++ VD+M LG+AC IEV Sbjct: 14 VGTKQVTKAVSQGKARVVFIARDAESHVTEPLWQLCRERGIEVIEVDSMKELGRACSIEV 73 Query: 74 GAAMAAVLKQ 83 G+A AA+L++ Sbjct: 74 GSASAAILEE 83 >ref|NP_623837.1| Ribosomal protein HS6-type (S12/L30/L7a) [Thermoanaerobacter tengcongensis] sp|Q8R7U8|RXL7_THETN Putative ribosomal protein L7Ae-like gb|AAM25441.1| Ribosomal protein HS6-type (S12/L30/L7a) [Thermoanaerobacter tengcongensis] Length = 82 Score = 69.3 bits (168), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 32/66 (48%), Positives = 48/66 (72%) Query: 14 IGTKQTVKAVELGQAAEVYVAEDGDQRLTSRIVMLCNKQGVKITYVDTMLNLGKACGIEV 73 +G KQT+KAV + A+VY+A+D ++ + +I C ++G+KI Y+DTM LG+ CGI+V Sbjct: 11 VGAKQTLKAVLNCKVAQVYIAKDAEEHVVKKIKEACEEKGIKIVYIDTMKELGRMCGIDV 70 Query: 74 GAAMAA 79 GAA AA Sbjct: 71 GAATAA 76 >ref|NP_240994.1| ribosomal protein L7AE family [Bacillus halodurans] sp|Q9Z9M0|RXL7_BACHD Putative ribosomal protein L7Ae-like pir||T44377 ribosomal protein L7AE family BH0128 [imported] - Bacillus halodurans (strain C-125) dbj|BAA75265.1| ybxF homologue (identity of 59% to B. subtilis ) [Bacillus halodurans] dbj|BAB03847.1| ribosomal protein L7AE family [Bacillus halodurans] Length = 82 Score = 65.9 bits (159), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 32/69 (46%), Positives = 49/69 (71%) Query: 14 IGTKQTVKAVELGQAAEVYVAEDGDQRLTSRIVMLCNKQGVKITYVDTMLNLGKACGIEV 73 IGTKQT+KA+E + EV +A+D + R+ +++ + + + + I YVD+M LGKACGI+V Sbjct: 14 IGTKQTLKALEQEEVLEVVIAKDAEPRVVNKVEAMASVKQIPIIYVDSMKKLGKACGIDV 73 Query: 74 GAAMAAVLK 82 GAA A+ K Sbjct: 74 GAATVALKK 82 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.317 0.131 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 92,244,501 Number of extensions: 2528879 Number of successful extensions: 7582 Number of sequences better than 1.0e-05: 31 Number of HSP's gapped: 7586 Number of HSP's successfully gapped: 31 Length of query: 83 Length of database: 757,237,578 Length adjustment: 52 Effective length of query: 31 Effective length of database: 616,052,430 Effective search space: 19097625330 Effective search space used: 19097625330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)