BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0188.0062.p (97 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_387999.1| ribosomal protein L23 [Bacillus subtilis] >gi|1... 124 4e-28 ref|NP_241002.1| 50S ribosomal protein L23; ribosomal protein L2... 124 5e-28 ref|NP_691042.1| 50S ribosomal protein L23 [Oceanobacillus iheye... 122 2e-27 dbj|BAA31209.1| ribosomal protrein L23 [Geobacillus stearothermo... 119 1e-26 sp|P04454|RL23_BACST 50S RIBOSOMAL PROTEIN L23 >gi|71295|pir||R5... 119 2e-26 >ref|NP_387999.1| ribosomal protein L23 [Bacillus subtilis] sp|P42924|RL23_BACSU 50S ribosomal protein L23 pir||A69697 ribosomal protein L23 - Bacillus subtilis dbj|BAA08833.1| Ribosomal Protein L23 [Bacillus subtilis] gb|AAC45958.1| L23 [Bacillus subtilis] emb|CAB11894.1| ribosomal protein L23 [Bacillus subtilis subsp. subtilis str. 168] Length = 95 Score = 124 bits (312), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 61/95 (64%), Positives = 74/95 (77%) Query: 1 MKDPRDIIKRPVITERTSEYMSELKYAFEVDIRANKTEIKKAVEAIFKVKVVSVNTMRVP 60 MKDPRD++KRPVITER+++ M+E KY FEVD+RANKTE K AVE+IF VKV VN M Sbjct: 1 MKDPRDVLKRPVITERSADLMTEEKYTFEVDVRANKTEAKDAVESIFGVKVDKVNIMNYK 60 Query: 61 GKLKRYGKYSGYTPEWKKAIVKLSQDSKPLEFFEA 95 GK KR G+Y+G T +KAIVKL+ DSK +E FEA Sbjct: 61 GKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA 95 >ref|NP_241002.1| 50S ribosomal protein L23; ribosomal protein L23 [Bacillus halodurans] sp|Q9Z9L2|RL23_BACHD 50S ribosomal protein L23 pir||T44385 ribosomal protein L23 rplW [imported] - Bacillus halodurans (strain C-125) dbj|BAA75273.1| rplW homologue (identity of 71% to B. subtilis ) [Bacillus halodurans] dbj|BAB03855.1| 50S ribosomal protein L23 [Bacillus halodurans] Length = 96 Score = 124 bits (312), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 60/96 (62%), Positives = 74/96 (77%) Query: 1 MKDPRDIIKRPVITERTSEYMSELKYAFEVDIRANKTEIKKAVEAIFKVKVVSVNTMRVP 60 M + RD+IKRPVITER++E M + KY FEVD+RANKT+IK A+E IF VKV VNTM Sbjct: 1 MSNARDVIKRPVITERSTEVMGDKKYTFEVDVRANKTQIKDAIEEIFDVKVAKVNTMNYK 60 Query: 61 GKLKRYGKYSGYTPEWKKAIVKLSQDSKPLEFFEAV 96 GK KR+G+Y+G+T KKAIV L+ DSK L+FFE V Sbjct: 61 GKPKRFGRYTGFTARRKKAIVTLTPDSKELDFFEGV 96 >ref|NP_691042.1| 50S ribosomal protein L23 [Oceanobacillus iheyensis HTE831] dbj|BAC12077.1| 50S ribosomal protein L23 [Oceanobacillus iheyensis HTE831] Length = 95 Score = 122 bits (307), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 61/95 (64%), Positives = 72/95 (75%) Query: 1 MKDPRDIIKRPVITERTSEYMSELKYAFEVDIRANKTEIKKAVEAIFKVKVVSVNTMRVP 60 MKD RD+IKRPVITE +++ M+E KY FEV +ANKTEIK AVE IF VKV VNTM Sbjct: 1 MKDLRDVIKRPVITEHSADLMAEKKYTFEVSPKANKTEIKDAVETIFGVKVEKVNTMNQK 60 Query: 61 GKLKRYGKYSGYTPEWKKAIVKLSQDSKPLEFFEA 95 GK KR G+Y GY P KKA+V+L+ DSK L+FFEA Sbjct: 61 GKFKRMGRYGGYRPNRKKAVVQLTADSKELDFFEA 95 >dbj|BAA31209.1| ribosomal protrein L23 [Geobacillus stearothermophilus] Length = 95 Score = 119 bits (299), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 59/95 (62%), Positives = 69/95 (72%) Query: 1 MKDPRDIIKRPVITERTSEYMSELKYAFEVDIRANKTEIKKAVEAIFKVKVVSVNTMRVP 60 MKDPRDIIKRP+ITE T + + KY FEVD++ANKTE+K AVE IF VKV VN M Sbjct: 1 MKDPRDIIKRPIITENTMNLIGQKKYTFEVDVKANKTEVKDAVEKIFGVKVAKVNIMNYK 60 Query: 61 GKLKRYGKYSGYTPEWKKAIVKLSQDSKPLEFFEA 95 GK KR G+YSGYT +KAIV L+ DSK +E FE Sbjct: 61 GKFKRVGRYSGYTNRRRKAIVTLTPDSKEIELFEV 95 >sp|P04454|RL23_BACST 50S RIBOSOMAL PROTEIN L23 pir||R5BS23 ribosomal protein L23 - Bacillus stearothermophilus Length = 95 Score = 119 bits (298), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 60/95 (63%), Positives = 69/95 (72%) Query: 1 MKDPRDIIKRPVITERTSEYMSELKYAFEVDIRANKTEIKKAVEAIFKVKVVSVNTMRVP 60 MKDPRDIIKRP+ITE T + + KY FEVD++ANKTE+K AVE IF VKV VN M Sbjct: 1 MKDPRDIIKRPIITENTMNLIGQKKYTFEVDVKANKTEVKDAVEKIFGVKVEKVNIMNYK 60 Query: 61 GKLKRYGKYSGYTPEWKKAIVKLSQDSKPLEFFEA 95 GK KR G+YSGYT KKAIV L+ DSK +E FE Sbjct: 61 GKFKRVGRYSGYTNRRKKAIVTLTPDSKEIELFEV 95 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.315 0.132 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 129,647,590 Number of extensions: 3986023 Number of successful extensions: 13104 Number of sequences better than 1.0e-05: 404 Number of HSP's gapped: 13120 Number of HSP's successfully gapped: 404 Length of query: 97 Length of database: 757,237,578 Length adjustment: 65 Effective length of query: 32 Effective length of database: 580,756,143 Effective search space: 18584196576 Effective search space used: 18584196576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)