BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0188.0060.p (92 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_388001.1| ribosomal protein S19 (BS19) [Bacillus subtilis... 166 1e-40 ref|NP_241004.1| 30S ribosomal protein S19; ribosomal protein S1... 163 1e-39 ref|NP_691044.1| 30S ribosomal protein S19 [Oceanobacillus iheye... 162 3e-39 ref|NP_830015.1| SSU ribosomal protein S19P [Bacillus cereus ATC... 161 5e-39 ref|NP_765375.1| 30S ribosomal protein S19 [Staphylococcus epide... 161 6e-39 >ref|NP_388001.1| ribosomal protein S19 (BS19) [Bacillus subtilis] sp|P21476|RS19_BACSU 30S ribosomal protein S19 (BS19) pir||B69701 ribosomal protein S19 (rpsS) - Bacillus subtilis dbj|BAA08835.1| Ribosomal Protein S19 [Bacillus subtilis] gb|AAC45960.1| S19 [Bacillus subtilis] emb|CAB11896.1| ribosomal protein S19 (BS19) [Bacillus subtilis subsp. subtilis str. 168] Length = 92 Score = 166 bits (421), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 76/92 (82%), Positives = 84/92 (91%) Query: 1 MGRSLKKGPFIDGYLLKKVEELNAADKKVVVKTWSRRSTIFPQFIGHTFGVYDGRKHVPV 60 M RSLKKGPF+DG+L+ K+E+LN DKK VVKTWSRRSTIFPQFIGHT VYDGRKHVPV Sbjct: 1 MARSLKKGPFVDGHLMTKIEKLNETDKKQVVKTWSRRSTIFPQFIGHTIAVYDGRKHVPV 60 Query: 61 YVTEDMVGHKLGEFAPTRTYKGHAGDDKKTRR 92 +++EDMVGHKLGEFAPTRTYKGHA DDKKTRR Sbjct: 61 FISEDMVGHKLGEFAPTRTYKGHASDDKKTRR 92 >ref|NP_241004.1| 30S ribosomal protein S19; ribosomal protein S19 (BS19) [Bacillus halodurans] sp|Q9Z9L0|RS19_BACHD 30S ribosomal protein S19 pir||T44387 ribosomal protein S19 (BS19) rpsS [imported] - Bacillus halodurans (strain C-125) dbj|BAA75275.1| rpsS homologue (identity of 87% to B. subtilis ) [Bacillus halodurans] dbj|BAB03857.1| 30S ribosomal protein S19 [Bacillus halodurans] Length = 92 Score = 163 bits (412), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 74/92 (80%), Positives = 84/92 (91%) Query: 1 MGRSLKKGPFIDGYLLKKVEELNAADKKVVVKTWSRRSTIFPQFIGHTFGVYDGRKHVPV 60 MGRSLKKGPF+D +L+KK+E LN ++ K VVKTWSRRSTIFP+F+GHT VYDGRKHVPV Sbjct: 1 MGRSLKKGPFVDDHLMKKIETLNESNDKKVVKTWSRRSTIFPEFVGHTIAVYDGRKHVPV 60 Query: 61 YVTEDMVGHKLGEFAPTRTYKGHAGDDKKTRR 92 Y++EDMVGHKLGEFAPTRTYKGHA DDKKTRR Sbjct: 61 YISEDMVGHKLGEFAPTRTYKGHAADDKKTRR 92 >ref|NP_691044.1| 30S ribosomal protein S19 [Oceanobacillus iheyensis HTE831] dbj|BAC12079.1| 30S ribosomal protein S19 [Oceanobacillus iheyensis HTE831] Length = 92 Score = 162 bits (409), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 75/92 (81%), Positives = 83/92 (90%) Query: 1 MGRSLKKGPFIDGYLLKKVEELNAADKKVVVKTWSRRSTIFPQFIGHTFGVYDGRKHVPV 60 MGRSLKKGPF D +L+KK+E LN DKK V+KTWSRRSTIFP F+GHT VYDGRKHVPV Sbjct: 1 MGRSLKKGPFADDHLMKKIEVLNTDDKKQVIKTWSRRSTIFPTFVGHTVAVYDGRKHVPV 60 Query: 61 YVTEDMVGHKLGEFAPTRTYKGHAGDDKKTRR 92 Y+TEDMVGHKLGEFAPTRTY+GHAGDDKKT+R Sbjct: 61 YITEDMVGHKLGEFAPTRTYRGHAGDDKKTKR 92 >ref|NP_830015.1| SSU ribosomal protein S19P [Bacillus cereus ATCC 14579] gb|AAP07216.1| SSU ribosomal protein S19P [Bacillus cereus ATCC 14579] Length = 92 Score = 161 bits (407), Expect = 5e-39, Method: Compositional matrix adjust. Identities = 74/92 (80%), Positives = 83/92 (90%) Query: 1 MGRSLKKGPFIDGYLLKKVEELNAADKKVVVKTWSRRSTIFPQFIGHTFGVYDGRKHVPV 60 M RSLKKGPF+D +L+ K+E+L A+++K VVKTWSRRSTIFPQFIGHT VYDGRKHVPV Sbjct: 1 MARSLKKGPFVDDHLMSKMEKLVASEQKQVVKTWSRRSTIFPQFIGHTIAVYDGRKHVPV 60 Query: 61 YVTEDMVGHKLGEFAPTRTYKGHAGDDKKTRR 92 Y+TEDMVGHKLGEFAPTRTYKGH DDKKTRR Sbjct: 61 YITEDMVGHKLGEFAPTRTYKGHLADDKKTRR 92 >ref|NP_765375.1| 30S ribosomal protein S19 [Staphylococcus epidermidis ATCC 12228] sp|Q8CRG4|RS19_STAEP 30S ribosomal protein S19 gb|AAO05461.1| 30S ribosomal protein S19 [Staphylococcus epidermidis ATCC 12228] Length = 92 Score = 161 bits (407), Expect = 6e-39, Method: Compositional matrix adjust. Identities = 74/92 (80%), Positives = 83/92 (90%) Query: 1 MGRSLKKGPFIDGYLLKKVEELNAADKKVVVKTWSRRSTIFPQFIGHTFGVYDGRKHVPV 60 M RS+KKGPF+D +L+KKVE + ++KK V+KTWSRRSTIFP FIGHTF VYDGRKHVPV Sbjct: 1 MARSIKKGPFVDDHLMKKVEAQDGSEKKQVIKTWSRRSTIFPNFIGHTFAVYDGRKHVPV 60 Query: 61 YVTEDMVGHKLGEFAPTRTYKGHAGDDKKTRR 92 YVTEDMVGHKLGEFAPTRT+KGHA DDKKTRR Sbjct: 61 YVTEDMVGHKLGEFAPTRTFKGHAADDKKTRR 92 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.320 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 146,973,777 Number of extensions: 5447682 Number of successful extensions: 10803 Number of sequences better than 1.0e-05: 614 Number of HSP's gapped: 10772 Number of HSP's successfully gapped: 614 Length of query: 92 Length of database: 757,237,578 Length adjustment: 60 Effective length of query: 32 Effective length of database: 594,331,638 Effective search space: 19018612416 Effective search space used: 19018612416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 120 (50.8 bits)