BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0188.0056.p (65 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_241008.1| 50S ribosomal protein L29; ribosomal protein L2... 107 9e-23 ref|NP_691048.1| 50S ribosomal protein L29 [Oceanobacillus iheye... 99 3e-20 ref|NP_976446.1| ribosomal protein L29 [Bacillus cereus ATCC 109... 97 1e-19 ref|NP_842686.1| ribosomal protein L29 [Bacillus anthracis str. ... 97 1e-19 ref|NP_388005.1| ribosomal protein L29 [Bacillus subtilis] >gi|1... 94 7e-19 >ref|NP_241008.1| 50S ribosomal protein L29; ribosomal protein L29 [Bacillus halodurans] sp|Q9Z9K6|RL29_BACHD 50S ribosomal protein L29 pir||F83667 ribosomal protein L29 rpmC [imported] - Bacillus halodurans (strain C-125) dbj|BAB03861.1| 50S ribosomal protein L29 [Bacillus halodurans] Length = 67 Score = 107 bits (267), Expect = 9e-23, Method: Compositional matrix adjust. Identities = 53/65 (81%), Positives = 57/65 (87%) Query: 1 MKANELRNLTTAEIEQKIAGFKEELFNLRFQLATGQLDNPTRIRDVRKEIARAKTVIHQR 60 MK NELRNLTTAEIEQK KEELFNLRFQLATGQLDNPTRIR+VRK IARAKTV+ +R Sbjct: 1 MKTNELRNLTTAEIEQKTKSLKEELFNLRFQLATGQLDNPTRIREVRKNIARAKTVLRER 60 Query: 61 VLGIS 65 LGI+ Sbjct: 61 ELGIN 65 >ref|NP_691048.1| 50S ribosomal protein L29 [Oceanobacillus iheyensis HTE831] sp|Q8ETX5|RL29_OCEIH 50S ribosomal protein L29 dbj|BAC12083.1| 50S ribosomal protein L29 [Oceanobacillus iheyensis HTE831] Length = 66 Score = 99.0 bits (245), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 48/65 (73%), Positives = 55/65 (84%) Query: 1 MKANELRNLTTAEIEQKIAGFKEELFNLRFQLATGQLDNPTRIRDVRKEIARAKTVIHQR 60 MKANE+R+LTTAEIEQK+ KEELFNLRFQLATGQL+N RIR+VRK IAR KTVI QR Sbjct: 1 MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIREVRKSIARMKTVIRQR 60 Query: 61 VLGIS 65 L ++ Sbjct: 61 ELSVN 65 >ref|NP_976446.1| ribosomal protein L29 [Bacillus cereus ATCC 10987] gb|AAS39054.1| ribosomal protein L29 [Bacillus cereus ATCC 10987] Length = 74 Score = 97.4 bits (241), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 46/65 (70%), Positives = 55/65 (84%) Query: 1 MKANELRNLTTAEIEQKIAGFKEELFNLRFQLATGQLDNPTRIRDVRKEIARAKTVIHQR 60 MK N++R LTTAEIE K+ KEELFNLRFQLATGQL+NPTRIR+VRK IAR KTV+ +R Sbjct: 9 MKTNDIRELTTAEIETKVKALKEELFNLRFQLATGQLENPTRIREVRKAIARMKTVVRER 68 Query: 61 VLGIS 65 +GI+ Sbjct: 69 EIGIN 73 >ref|NP_842686.1| ribosomal protein L29 [Bacillus anthracis str. Ames] sp|Q81VS2|RL29_BACAA 50S ribosomal protein L29 gb|AAP24172.1| ribosomal protein L29 [Bacillus anthracis str. Ames] Length = 66 Score = 96.7 bits (239), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 46/65 (70%), Positives = 55/65 (84%) Query: 1 MKANELRNLTTAEIEQKIAGFKEELFNLRFQLATGQLDNPTRIRDVRKEIARAKTVIHQR 60 MK N++R LTTAEIE K+ KEELFNLRFQLATGQL+NPTRIR+VRK IAR KTV+ +R Sbjct: 1 MKTNDIRELTTAEIETKVKALKEELFNLRFQLATGQLENPTRIREVRKAIARMKTVVRER 60 Query: 61 VLGIS 65 +GI+ Sbjct: 61 EIGIN 65 >ref|NP_388005.1| ribosomal protein L29 [Bacillus subtilis] sp|P12873|RL29_BACSU 50S ribosomal protein L29 pir||R5BS2L ribosomal protein L29 - Bacillus subtilis emb|CAA33699.1| unnamed protein product [Bacillus subtilis] gb|AAB06807.1| ribosomal protein L29 emb|CAB11900.1| ribosomal protein L29 [Bacillus subtilis subsp. subtilis str. 168] Length = 66 Score = 94.4 bits (233), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 46/63 (73%), Positives = 53/63 (84%) Query: 1 MKANELRNLTTAEIEQKIAGFKEELFNLRFQLATGQLDNPTRIRDVRKEIARAKTVIHQR 60 MKANE+R+LTTAEIEQK+ KEELFNLRFQLATGQL+N RIR+VRK IAR KTVI +R Sbjct: 1 MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIREVRKAIARMKTVIRER 60 Query: 61 VLG 63 + Sbjct: 61 EIA 63 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.321 0.135 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 76,840,571 Number of extensions: 2072464 Number of successful extensions: 6323 Number of sequences better than 1.0e-05: 206 Number of HSP's gapped: 6363 Number of HSP's successfully gapped: 206 Length of query: 65 Length of database: 757,237,578 Length adjustment: 36 Effective length of query: 29 Effective length of database: 659,494,014 Effective search space: 19125326406 Effective search space used: 19125326406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)