BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0188.0053.p (114 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_388008.1| ribosomal protein L24 (BL23) (histone-like prot... 138 3e-32 gb|AAB59024.1| ribosomal protein L24 137 8e-32 sp|P04455|RL24_BACST 50S RIBOSOMAL PROTEIN L24 >gi|71304|pir||R5... 135 3e-31 ref|NP_654064.1| Ribosomal_L24, KOW motif [Bacillus anthracis A2... 133 1e-30 ref|NP_241011.1| 50S ribosomal protein L24; ribosomal protein L2... 132 3e-30 >ref|NP_388008.1| ribosomal protein L24 (BL23) (histone-like protein HPB12) [Bacillus subtilis] sp|P12876|RL24_BACSU 50S ribosomal protein L24 (BL23) (12 kDa DNA-binding protein) (HPB12) pir||R5BS2B ribosomal protein L24 - Bacillus subtilis emb|CAA33702.1| unnamed protein product [Bacillus subtilis] gb|AAB59023.1| ribosomal protein L24 gb|AAB06810.1| ribosomal protein L24 emb|CAB11903.1| ribosomal protein L24 (BL23) (histone-like protein HPB12) [Bacillus subtilis subsp. subtilis str. 168] Length = 103 Score = 138 bits (348), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 67/92 (72%), Positives = 82/92 (89%), Gaps = 1/92 (1%) Query: 23 ISGKDKGKKGRVIAAYPRENRVLVEGVNMVKKHQKPNQLNPQGGIIEQEASIHVSNVMHI 82 ISGKDKGK+G ++AA+P+++RVLVEGVNMVKKH KP Q NPQGGI QEA IHVSNVM + Sbjct: 12 ISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQANPQGGISNQEAPIHVSNVMPL 71 Query: 83 DPKSGKVTRIGYKVLDNGKKVRVAKRSGEIID 114 DPK+G+VTR+GYKV D GKKVRVAK+SG+++D Sbjct: 72 DPKTGEVTRVGYKVED-GKKVRVAKKSGQVLD 102 >gb|AAB59024.1| ribosomal protein L24 Length = 103 Score = 137 bits (345), Expect = 8e-32, Method: Compositional matrix adjust. Identities = 66/91 (72%), Positives = 81/91 (89%), Gaps = 1/91 (1%) Query: 24 SGKDKGKKGRVIAAYPRENRVLVEGVNMVKKHQKPNQLNPQGGIIEQEASIHVSNVMHID 83 SGKDKGK+G ++AA+P+++RVLVEGVNMVKKH KP Q NPQGGI QEA IHVSNVM +D Sbjct: 13 SGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQANPQGGISNQEAPIHVSNVMPLD 72 Query: 84 PKSGKVTRIGYKVLDNGKKVRVAKRSGEIID 114 PK+G+VTR+GYKV D GKKVRVAK+SG+++D Sbjct: 73 PKTGEVTRVGYKVED-GKKVRVAKKSGQVLD 102 >sp|P04455|RL24_BACST 50S RIBOSOMAL PROTEIN L24 pir||R5BS24 ribosomal protein L24 - Bacillus stearothermophilus Length = 103 Score = 135 bits (340), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 66/92 (71%), Positives = 83/92 (90%), Gaps = 1/92 (1%) Query: 23 ISGKDKGKKGRVIAAYPRENRVLVEGVNMVKKHQKPNQLNPQGGIIEQEASIHVSNVMHI 82 ISGKDKGK+G ++AA+P++NRV+VEGVN+VKKH KP+Q NPQGGIIE+EA IHVS VM + Sbjct: 12 ISGKDKGKQGVILAAFPKKNRVIVEGVNIVKKHAKPSQANPQGGIIEKEAPIHVSKVMPL 71 Query: 83 DPKSGKVTRIGYKVLDNGKKVRVAKRSGEIID 114 DPK+G+ TRIGYK++D GKKVR AK+SGEI+D Sbjct: 72 DPKTGEPTRIGYKIVD-GKKVRYAKKSGEILD 102 >ref|NP_654064.1| Ribosomal_L24, KOW motif [Bacillus anthracis A2012] ref|NP_830022.1| LSU ribosomal protein L24P [Bacillus cereus ATCC 14579] ref|NP_842689.1| ribosomal protein L24 [Bacillus anthracis str. Ames] ref|NP_976449.1| ribosomal protein L24 [Bacillus cereus ATCC 10987] gb|AAP07223.1| LSU ribosomal protein L24P [Bacillus cereus ATCC 14579] gb|AAP24175.1| ribosomal protein L24 [Bacillus anthracis str. Ames] gb|AAS39057.1| ribosomal protein L24 [Bacillus cereus ATCC 10987] Length = 103 Score = 133 bits (335), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 63/92 (68%), Positives = 83/92 (90%), Gaps = 1/92 (1%) Query: 23 ISGKDKGKKGRVIAAYPRENRVLVEGVNMVKKHQKPNQLNPQGGIIEQEASIHVSNVMHI 82 I+GKDKGK+G ++ A+P++NRV+VEGVN+VKKH KP+QLNPQGGII +EA IHVSNVM + Sbjct: 12 ITGKDKGKQGVILVAFPKQNRVIVEGVNIVKKHSKPSQLNPQGGIITKEAPIHVSNVMIL 71 Query: 83 DPKSGKVTRIGYKVLDNGKKVRVAKRSGEIID 114 DPK+G+ TR+G+KV D GKKVR+AK+SGE++D Sbjct: 72 DPKTGEPTRVGFKVED-GKKVRIAKKSGELLD 102 >ref|NP_241011.1| 50S ribosomal protein L24; ribosomal protein L24 (BL23) [Bacillus halodurans] sp|Q9Z9K3|RL24_BACHD 50S ribosomal protein L24 pir||T44394 ribosomal protein L24 (BL23) rplX [imported] - Bacillus halodurans (strain C-125) dbj|BAA75282.1| rplX homologue (identity of 84% to B. subtilis ) [Bacillus halodurans] dbj|BAB03864.1| 50S ribosomal protein L24 [Bacillus halodurans] Length = 103 Score = 132 bits (331), Expect = 3e-30, Method: Compositional matrix adjust. Identities = 64/92 (69%), Positives = 82/92 (89%), Gaps = 1/92 (1%) Query: 23 ISGKDKGKKGRVIAAYPRENRVLVEGVNMVKKHQKPNQLNPQGGIIEQEASIHVSNVMHI 82 ISGKDKGK+G ++ AYP+++RVLVEGVN+VKKH KP+Q NPQGGI+ EA IHVSNV+ I Sbjct: 12 ISGKDKGKQGVILEAYPKKDRVLVEGVNIVKKHAKPSQENPQGGILNMEAPIHVSNVLPI 71 Query: 83 DPKSGKVTRIGYKVLDNGKKVRVAKRSGEIID 114 DPK+G+ TR+GYKV +NGKKVR+AK+SGE++D Sbjct: 72 DPKTGEPTRVGYKV-ENGKKVRIAKKSGEVLD 102 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.312 0.133 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 150,334,424 Number of extensions: 5390090 Number of successful extensions: 10319 Number of sequences better than 1.0e-05: 510 Number of HSP's gapped: 9786 Number of HSP's successfully gapped: 510 Length of query: 114 Length of database: 757,237,578 Length adjustment: 79 Effective length of query: 35 Effective length of database: 542,744,757 Effective search space: 18996066495 Effective search space used: 18996066495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 120 (50.8 bits)