BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0188.0040.p (37 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_241025.1| 50S ribosomal protein L36; ribosomal protein L3... 74 1e-12 ref|NP_388021.1| ribosomal protein L36 (ribosomal protein B) [Ba... 71 6e-12 ref|NP_830034.1| LSU ribosomal protein L36P [Bacillus cereus ATC... 70 1e-11 ref|NP_472087.1| ribosomal protein L36 [Listeria innocua] >gi|16... 70 1e-11 ref|NP_349708.1| Ribosomal protein L36 [Clostridium acetobutylic... 70 1e-11 >ref|NP_241025.1| 50S ribosomal protein L36; ribosomal protein L36 [Bacillus halodurans] sp|O50631|RL36_BACHD 50S ribosomal protein L36 pir||T44407 ribosomal protein L36 rpmJ [imported] - Bacillus halodurans (strain C-125) dbj|BAA24191.1| ribosomal protein L36 [Bacillus halodurans] dbj|BAA75295.1| rpmJ homologue (identity of 97% to B. subtilis ) [Bacillus halodurans] dbj|BAB03878.1| 50S ribosomal protein L36 [Bacillus halodurans] Length = 37 Score = 73.9 bits (180), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 37/37 (100%), Positives = 37/37 (100%) Query: 1 MKVRPSVKPICEKCKVIRRKGTVMVICENPKHKQKQG 37 MKVRPSVKPICEKCKVIRRKGTVMVICENPKHKQKQG Sbjct: 1 MKVRPSVKPICEKCKVIRRKGTVMVICENPKHKQKQG 37 >ref|NP_388021.1| ribosomal protein L36 (ribosomal protein B) [Bacillus subtilis] sp|P20278|RL36_BACSU 50S ribosomal protein L36 (Ribosomal protein II) (Ribosomal protein B) (BL38) pir||B32307 ribosomal protein L36 - Bacillus subtilis gb|AAA22214.1| ribosomal protein B [Bacillus subtilis] gb|AAB06823.1| ribosomal protein B emb|CAB11916.1| ribosomal protein L36 (ribosomal protein B) [Bacillus subtilis subsp. subtilis str. 168] Length = 37 Score = 71.2 bits (173), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 36/37 (97%), Positives = 36/37 (97%) Query: 1 MKVRPSVKPICEKCKVIRRKGTVMVICENPKHKQKQG 37 MKVRPSVKPICEKCKVIRRKG VMVICENPKHKQKQG Sbjct: 1 MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG 37 >ref|NP_830034.1| LSU ribosomal protein L36P [Bacillus cereus ATCC 14579] ref|NP_842702.1| ribosomal protein L36 [Bacillus anthracis str. Ames] ref|NP_976462.1| ribosomal protein L36 [Bacillus cereus ATCC 10987] gb|AAP07235.1| LSU ribosomal protein L36P [Bacillus cereus ATCC 14579] gb|AAP24188.1| ribosomal protein L36 [Bacillus anthracis str. Ames] gb|AAS39070.1| ribosomal protein L36 [Bacillus cereus ATCC 10987] Length = 37 Score = 70.5 bits (171), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 35/37 (94%), Positives = 36/37 (97%) Query: 1 MKVRPSVKPICEKCKVIRRKGTVMVICENPKHKQKQG 37 MKVRPSVKPICEKCKVIRR+G VMVICENPKHKQKQG Sbjct: 1 MKVRPSVKPICEKCKVIRRRGKVMVICENPKHKQKQG 37 >ref|NP_472087.1| ribosomal protein L36 [Listeria innocua] ref|NP_466132.1| ribosomal protein L36 [Listeria monocytogenes EGD-e] sp|Q927N0|RL36_LISMO 50S ribosomal protein L36 pir||AH1776 ribosomal protein L36 [imported] - Listeria innocua (strain Clip11262) pir||AI1400 ribosomal protein L36 [imported] - Listeria monocytogenes (strain EGD-e) emb|CAD00687.1| ribosomal protein L36 [Listeria monocytogenes] emb|CAC97984.1| ribosomal protein L36 [Listeria innocua] Length = 37 Score = 70.5 bits (171), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 35/37 (94%), Positives = 36/37 (97%) Query: 1 MKVRPSVKPICEKCKVIRRKGTVMVICENPKHKQKQG 37 MKVRPSVKP+CEKCKVIRRKG VMVICENPKHKQKQG Sbjct: 1 MKVRPSVKPMCEKCKVIRRKGKVMVICENPKHKQKQG 37 >ref|NP_349708.1| Ribosomal protein L36 [Clostridium acetobutylicum] sp|Q97EK2|RL36_CLOAB 50S ribosomal protein L36 pir||E97282 ribosomal protein L36 [imported] - Clostridium acetobutylicum gb|AAK81048.1| Ribosomal protein L36 [Clostridium acetobutylicum] Length = 37 Score = 70.1 bits (170), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 35/37 (94%), Positives = 36/37 (97%) Query: 1 MKVRPSVKPICEKCKVIRRKGTVMVICENPKHKQKQG 37 MKVRPSVKPICEKCKVI+RKG VMVICENPKHKQKQG Sbjct: 1 MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQKQG 37 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.322 0.136 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 50,667,841 Number of extensions: 925656 Number of successful extensions: 2531 Number of sequences better than 1.0e-05: 174 Number of HSP's gapped: 2510 Number of HSP's successfully gapped: 174 Length of query: 37 Length of database: 757,237,578 Length adjustment: 11 Effective length of query: 26 Effective length of database: 727,371,489 Effective search space: 18911658714 Effective search space used: 18911658714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 120 (50.8 bits)