BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0188.0038.p (131 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_241027.1| 30S ribosomal protein S11; ribosomal protein S1... 187 6e-47 sp|P10789|RS11_BACST 30S ribosomal protein S11 (BS11) 180 9e-45 ref|NP_388023.1| ribosomal protein S11 (BS11) [Bacillus subtilis... 180 1e-44 pir||R3BS11 ribosomal protein S11 [validated] - Bacillus stearot... 180 1e-44 ref|NP_349706.1| Ribosomal protein S11 [Clostridium acetobutylic... 177 6e-44 >ref|NP_241027.1| 30S ribosomal protein S11; ribosomal protein S11 (BS11) [Bacillus halodurans] sp|O50633|RS11_BACHD 30S ribosomal protein S11 pir||T44409 ribosomal protein S11 (BS11) rpsK [imported] - Bacillus halodurans (strain C-125) dbj|BAA24193.1| ribosomal protein S11 [Bacillus halodurans] dbj|BAA75297.1| rpsK homologue (identity of 82% to B. subtilis ) [Bacillus halodurans] dbj|BAB03880.1| 30S ribosomal protein S11 [Bacillus halodurans] Length = 129 Score = 187 bits (475), Expect = 6e-47, Method: Compositional matrix adjust. Identities = 93/115 (80%), Positives = 98/115 (85%) Query: 17 NIESGVAHIRSTFNNTIVTITDPHGNAISWASSGGQGFKGSRKSTPFXXXXXXXXXXXXX 76 N+E+GVAHIRSTFNNTIVTITDPHGNAISWAS+G GFKGSRKSTPF Sbjct: 15 NVETGVAHIRSTFNNTIVTITDPHGNAISWASAGALGFKGSRKSTPFAAQMAAETAAKAA 74 Query: 77 MEHGMKSVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPVPHNGCRPPKRRRV 131 MEHGMKS+EV VKGPGAGREAAIRSLQA GLEVN+IKDVTPVPHNGCRPPKRRRV Sbjct: 75 MEHGMKSIEVSVKGPGAGREAAIRSLQAVGLEVNMIKDVTPVPHNGCRPPKRRRV 129 >sp|P10789|RS11_BACST 30S ribosomal protein S11 (BS11) Length = 129 Score = 180 bits (457), Expect = 9e-45, Method: Compositional matrix adjust. Identities = 85/115 (73%), Positives = 96/115 (83%) Query: 17 NIESGVAHIRSTFNNTIVTITDPHGNAISWASSGGQGFKGSRKSTPFXXXXXXXXXXXXX 76 NI++G+AHIRSTFNNTIVTITD HGNA++WAS+G GFKGSRKSTPF Sbjct: 15 NIDTGIAHIRSTFNNTIVTITDVHGNALAWASAGSLGFKGSRKSTPFAAQMAAEAAAKAS 74 Query: 77 MEHGMKSVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPVPHNGCRPPKRRRV 131 MEHGMK+VEV VKGPGAGREAAIR+LQAAGLE+ IKDVTP+PH+GCRPPKRRRV Sbjct: 75 MEHGMKTVEVNVKGPGAGREAAIRALQAAGLEITAIKDVTPIPHDGCRPPKRRRV 129 >ref|NP_388023.1| ribosomal protein S11 (BS11) [Bacillus subtilis] sp|P04969|RS11_BACSU 30S ribosomal protein S11 (BS11) pir||R3BSS1 ribosomal protein S11 - Bacillus subtilis gb|AAA22216.1| ribosomal protein S11 [Bacillus subtilis] gb|AAA22707.1| ribosomal protein S11 gb|AAB06825.1| ribosomal protein S11 emb|CAB11918.1| ribosomal protein S11 (BS11) [Bacillus subtilis subsp. subtilis str. 168] Length = 131 Score = 180 bits (456), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 85/115 (73%), Positives = 96/115 (83%) Query: 17 NIESGVAHIRSTFNNTIVTITDPHGNAISWASSGGQGFKGSRKSTPFXXXXXXXXXXXXX 76 NIESG+AHIRSTFNNTIVTITD HGNAISW+S+G GF+GSRKSTPF Sbjct: 17 NIESGIAHIRSTFNNTIVTITDTHGNAISWSSAGALGFRGSRKSTPFAAQMAAETAAKGS 76 Query: 77 MEHGMKSVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPVPHNGCRPPKRRRV 131 +EHG+K++EV VKGPG+GREAAIR+LQAAGLEV I+DVTPVPHNGCRPPKRRRV Sbjct: 77 IEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRRV 131 >pir||R3BS11 ribosomal protein S11 [validated] - Bacillus stearothermophilus prf||1501255A ribosomal protein S11 Length = 128 Score = 180 bits (456), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 85/115 (73%), Positives = 96/115 (83%) Query: 17 NIESGVAHIRSTFNNTIVTITDPHGNAISWASSGGQGFKGSRKSTPFXXXXXXXXXXXXX 76 NI++G+AHIRSTFNNTIVTITD HGNA++WAS+G GFKGSRKSTPF Sbjct: 14 NIDTGIAHIRSTFNNTIVTITDVHGNALAWASAGSLGFKGSRKSTPFAAQMAAEAAAKAS 73 Query: 77 MEHGMKSVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPVPHNGCRPPKRRRV 131 MEHGMK+VEV VKGPGAGREAAIR+LQAAGLE+ IKDVTP+PH+GCRPPKRRRV Sbjct: 74 MEHGMKTVEVNVKGPGAGREAAIRALQAAGLEITAIKDVTPIPHDGCRPPKRRRV 128 >ref|NP_349706.1| Ribosomal protein S11 [Clostridium acetobutylicum] pir||C97282 ribosomal protein S11 [imported] - Clostridium acetobutylicum gb|AAK81046.1| Ribosomal protein S11 [Clostridium acetobutylicum] Length = 131 Score = 177 bits (449), Expect = 6e-44, Method: Compositional matrix adjust. Identities = 85/114 (74%), Positives = 95/114 (83%) Query: 18 IESGVAHIRSTFNNTIVTITDPHGNAISWASSGGQGFKGSRKSTPFXXXXXXXXXXXXXM 77 IE G AHI+STFNN+IVTITD +GNA+SW+S+GG GFKGSRKSTPF M Sbjct: 18 IEHGCAHIKSTFNNSIVTITDVNGNALSWSSAGGLGFKGSRKSTPFAAQMAAETAAKTAM 77 Query: 78 EHGMKSVEVMVKGPGAGREAAIRSLQAAGLEVNLIKDVTPVPHNGCRPPKRRRV 131 EHG+KSV+V VKGPG+GREAAIRSLQAAGLEV LIKDVTP+PHNGCRPPKRRRV Sbjct: 78 EHGLKSVDVFVKGPGSGREAAIRSLQAAGLEVTLIKDVTPIPHNGCRPPKRRRV 131 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.316 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 162,261,202 Number of extensions: 4996265 Number of successful extensions: 12944 Number of sequences better than 1.0e-05: 758 Number of HSP's gapped: 12810 Number of HSP's successfully gapped: 758 Length of query: 131 Length of database: 757,237,578 Length adjustment: 94 Effective length of query: 37 Effective length of database: 502,018,272 Effective search space: 18574676064 Effective search space used: 18574676064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 120 (50.8 bits)