BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0183.0003.p (76 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 2,715,099 sequences; 757,237,578 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_294139.1| ppGpp-regulated growth inhibitor suppressor Chp... 80 1e-14 ref|NP_711961.1| probable ppGpp-regulated growth inhibitor suppr... 78 6e-14 ref|NP_487252.1| cell growth regulatory protein [Nostoc sp. PCC ... 77 1e-13 ref|NP_244587.1| suppressor of ppGpp-regulated growth inhibitor ... 66 3e-10 ref|NP_289337.1| suppressor of inhibitory function of ChpA, PemI... 64 1e-09 >ref|NP_294139.1| ppGpp-regulated growth inhibitor suppressor ChpR/MazE, putative [Deinococcus radiodurans] pir||A75523 probable ppGpp-regulated growth inhibitor suppressor ChpR/ MazE - Deinococcus radiodurans (strain R1) gb|AAF09994.1| ppGpp-regulated growth inhibitor suppressor ChpR/MazE, putative [Deinococcus radiodurans] Length = 80 Score = 80.5 bits (197), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 38/77 (49%), Positives = 56/77 (72%), Gaps = 3/77 (3%) Query: 3 QVQKWGNSLGIRIPKSLALKVGIEEGSEVDLDVEDGHLIIKPKSAT---LDEILSQVTPD 59 Q+QKWGNSL +RIPK+LA +VG+ + SEV+L ++DG ++I+P A L +L+++TP+ Sbjct: 4 QIQKWGNSLALRIPKALAQQVGLTQSSEVELLLQDGQIVIRPVPARQYDLAALLAEMTPE 63 Query: 60 NLHHEVSTGEQQGREVW 76 NLH E G +GRE W Sbjct: 64 NLHGETDWGALEGREEW 80 >ref|NP_711961.1| probable ppGpp-regulated growth inhibitor suppressor ChpR/ MazE [Leptospira interrogans serovar lai str. 56601] gb|AAN48979.1| probable ppGpp-regulated growth inhibitor suppressor ChpR/ MazE [Leptospira interrogans serovar lai str. 56601] Length = 78 Score = 78.2 bits (191), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 37/74 (50%), Positives = 53/74 (71%), Gaps = 1/74 (1%) Query: 4 VQKWGNSLGIRIPKSLALKVGIEEGSEVDLDVEDGHLIIKP-KSATLDEILSQVTPDNLH 62 +QKWGNSLGIRIPK++A ++ + +GS V+L E ++I P K A+L++ LS++T NLH Sbjct: 5 IQKWGNSLGIRIPKAMATELELNDGSHVELQYEGDKIVIYPMKKASLEDKLSKITKQNLH 64 Query: 63 HEVSTGEQQGREVW 76 E+STG G E W Sbjct: 65 SEISTGNSIGNEAW 78 >ref|NP_487252.1| cell growth regulatory protein [Nostoc sp. PCC 7120] pir||AE2207 cell growth regulatory protein mazE [imported] - Nostoc sp. (strain PCC 7120) dbj|BAB74911.1| cell growth regulatory protein [Nostoc sp. PCC 7120] Length = 80 Score = 77.0 bits (188), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 3/76 (3%) Query: 4 VQKWGNSLGIRIPKSLALKVGIEEGSEVDLDVEDGHLIIKP---KSATLDEILSQVTPDN 60 V KWGNSL +RIP+S+A + + EG++++ VE ++I P K TLDE+L +TPDN Sbjct: 5 VAKWGNSLAVRIPRSIAEQAHVTEGTDINFSVEGNSIVITPKRRKKYTLDELLEGMTPDN 64 Query: 61 LHHEVSTGEQQGREVW 76 H E TG+ G E W Sbjct: 65 FHPEFETGDAVGNEAW 80 >ref|NP_244587.1| suppressor of ppGpp-regulated growth inhibitor (ChpA/MazF) [Bacillus halodurans] pir||H84114 suppressor of ppGpp-regulated growth inhibitor (ChpA/MazF) BH3720 [imported] - Bacillus halodurans (strain C-125) dbj|BAB07439.1| suppressor of ppGpp-regulated growth inhibitor (ChpA/MazF) [Bacillus halodurans] Length = 81 Score = 65.9 bits (159), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 32/78 (41%), Positives = 54/78 (69%), Gaps = 4/78 (5%) Query: 1 MFQVQKWGNSLGIRIPKSLALKVGIEEGSEVDLDV-EDGHLIIKPK--SATLDEILSQVT 57 M +QKWGNSL +RIP A + + +GSE++L + D +I+KPK TL+E+++++T Sbjct: 4 MTTIQKWGNSLAVRIPNHYAKHINVTQGSEIELSLGSDQTIILKPKKRKPTLEELVAKIT 63 Query: 58 PDNLHHEVSTGEQQGREV 75 P+N H+E+ G + G+E+ Sbjct: 64 PENRHNEIDFG-RTGKEL 80 >ref|NP_289337.1| suppressor of inhibitory function of ChpA, PemI-like, autoregulated [Escherichia coli O157:H7 EDL933] ref|NP_311670.1| suppressor of ChpA inhibitory function [Escherichia coli O157:H7] ref|NP_417263.1| ChpR [Escherichia coli K12] sp|P18534|CHPR_ECOLI PemI-like protein 1 (MazE protein) pir||BVECZE cell growth regulatory protein mazE - Escherichia coli (strain K-12) pir||C91084 suppressor of ChpA inhibitory function [imported] - Escherichia coli (strain O157:H7, substrain RIMD 0509952) pir||D85929 hypothetical protein chpR [imported] - Escherichia coli (strain O157:H7, substrain EDL933) pdb|1MVF|D Chain D, Maze Addiction Antidote pdb|1MVF|E Chain E, Maze Addiction Antidote gb|AAA03238.1| homologous to plasmid R100 pemI gene dbj|BAA41177.1| ChpAI [Escherichia coli] gb|AAA69293.1| pemI-like protein 1 [Escherichia coli] gb|AAC75825.1| suppressor of inhibitory function of ChpA, PemI-like, autoregulated [Escherichia coli K12] gb|AAG57896.1| suppressor of inhibitory function of ChpA, PemI-like, autoregulated [Escherichia coli O157:H7 EDL933] dbj|BAB37066.1| suppressor of ChpA inhibitory function [Escherichia coli O157:H7] Length = 82 Score = 63.9 bits (154), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 4/77 (5%) Query: 4 VQKWGNSLGIRIPKSLALKVGIEEGSEVDLDVEDGHLIIKPKSA----TLDEILSQVTPD 59 V++WGNS +RIP +L + + EV +D+ DG LII+P TL E+++ +TP+ Sbjct: 6 VKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRKEPVFTLAELVNDITPE 65 Query: 60 NLHHEVSTGEQQGREVW 76 NLH + GE + +EVW Sbjct: 66 NLHENIDWGEPKDKEVW 82 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 24, 2004 1:53 AM Number of letters in database: 757,237,578 Number of sequences in database: 2,715,099 Lambda K H 0.312 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 2715099 Number of Hits to DB: 112,092,019 Number of extensions: 3760049 Number of successful extensions: 8519 Number of sequences better than 1.0e-05: 8 Number of HSP's gapped: 8513 Number of HSP's successfully gapped: 8 Length of query: 76 Length of database: 757,237,578 Length adjustment: 46 Effective length of query: 30 Effective length of database: 632,343,024 Effective search space: 18970290720 Effective search space used: 18970290720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 120 (50.8 bits)